• PSA: Using the PC adb to save a list of all Android apps installed by the user in order

    From Maria Sophia@mariasophia@comprehension.com to comp.mobile.android,alt.comp.os.windows-10,alt.os.linux on Sun May 31 10:46:30 2026
    From Newsgroup: alt.os.linux

    PSA:
    Use the PC to save a list of all Android apps installed by the user
    in the order apps were installed (FIFO) for current/future reference.

    BACKGROUND:
    By now, on Windows, Android & on iOS, I think I've pretty much tested all
    the decent useful (free, no ads, no logins, etc.) software that exists.

    But have I?

    Dunno. So I needed a listing of all the apps I installed, which is
    trivial to create, but there's no useful order to that listing:
    adb shell package list packages -3 (recently deprecated)
    adb shell cmd package list packages -3

    That's all the apps I've installed on my 64GB free Android A32-5G.
    But when did I install them (the better apps being installed first)?

    Below is a PC script that I tested just now that I hacked out.
    It saves all the apps installed by the user to a file by install date.

    I'll send out a separate (untested) Linux script, as the only difference
    is in the file specs so I have confidence someone will test it for us.

    adb devices
    List of devices attached
    adb pair 192.168.1.4:37101 132022
    Successfully paired to 192.168.1.4:37101 [guid=adb-SERIAL]
    adb connect 192.168.1.4:46471
    connected to 192.168.1.4:46471
    adb devices
    List of devices attached
    192.168.1.4:46471 device
    type getapkorder.bat
    @echo off
    :: getapkorder.bat
    :: Lists all user-installed Android apps sorted by installation date.
    :: Requires Android connected via USB/Wi-Fi with ADB Debugging enabled.
    :: Version: v1p3 20260531

    title Android App Install Order Exporter

    echo Make sure your phone is plugged in and USB Debugging is ON.
    echo Click "Allow" on your phone's screen if a permission prompt appears.
    echo.
    echo Working... Querying individual app installation timestamps.
    echo This window may look completely frozen for 1-2 minutes as it crunches.
    echo Please do not close it.
    echo.

    powershell -NoProfile -ExecutionPolicy Bypass -Command ^
    "$apps = .\adb shell cmd package list packages -3 | ForEach-Object { $_ -replace 'package:', '' };" ^
    "$report = foreach ($app in $apps) {" ^
    " if ($app.trim()) {" ^
    " $installTimeRaw = .\adb shell \"dumpsys package $app\" | Select-String \"firstInstallTime\";" ^
    " if ($installTimeRaw) {" ^
    " $dateString = ($installTimeRaw -split \"firstInstallTime=\")[1].Trim();" ^
    " [PSCustomObject]@{" ^
    " PackageName = $app.Trim();" ^
    " InstallTime = [DateTime]$dateString;" ^
    " }" ^
    " }" ^
    " }" ^
    "};" ^
    "$report | Sort-Object InstallTime | Format-Table -AutoSize | Out-File -FilePath \"$HOME\Desktop\installed_apps_ordered.txt\""

    echo.
    echo [+][+][+] Success! Finished Processing [+][+][+]
    echo File 'installed_apps_ordered.txt' has been saved to your Desktop.
    echo.
    pause
    :: end of getapkorder.bat

    getapkorder.bat
    Make sure your phone is plugged in and USB Debugging is ON.
    Click "Allow" on your phone's screen if a permission prompt appears.
    Working... Querying individual app installation timestamps.
    This window may look completely frozen for 1-2 minutes...
    Please do not close it.
    [+][+][+] Success! Finished Processing [+][+][+]
    File 'installed_apps_ordered.txt' has been saved to your Desktop.
    Press any key to continue . . .

    type $HOME\installed_apps_ordered.txt

    Since this is long, but since it's designed to be useful to everyone,
    I'll provide the output (by way of example) & a Linux variant separately.

    As always, please improve so all benefit, and, if/when I err or omit,
    please add the incorrect/missing value so that everyone benefits always.
    --
    Every Usenet post should strive to add palpable additional value
    so that we can all delight in dissemination of useful knowledge.
    --- Synchronet 3.22a-Linux NewsLink 1.2
  • From Maria Sophia@mariasophia@comprehension.com to comp.mobile.android,alt.comp.os.windows-10,alt.os.linux on Sun May 31 10:51:48 2026
    From Newsgroup: alt.os.linux

    Maria Sophia wrote:
    I'll send out a separate (untested) Linux script, as the only difference
    is in the file specs so I have confidence someone will test it for us.

    Untested Linux variant.

    To run:
    $ chmod +x getapkorder.sh
    $ ./getapkorder.sh

    #!/bin/bash
    # getapkorder.sh
    # Lists all user-installed Android apps sorted by installation date.
    # Requires Android connected via USB/Wi-Fi with ADB Debugging enabled.
    # Version: v1p0-linux 20260531

    echo "Make sure your phone is plugged in and USB Debugging is ON."
    echo "Click 'Allow' on your phone's screen if a permission prompt appears."
    echo ""
    echo "Working... Querying individual app installation timestamps."
    echo "This window may look completely frozen for 1-2 minutes as it crunches."
    echo "Please do not close it."
    echo ""

    # Create a temporary file to hold the raw output
    tmp_file=$(mktemp)

    # 1. Get a clean list of all 3rd-party package names
    apps=$(./adb shell cmd package list packages -3 | sed 's/package://g')

    # 2. Loop through each app to find its original installation timestamp
    for app in $apps; do
    if [ -n "$app" ]; then
    # Fetch the install time line from dumpsys
    installTimeRaw=$(./adb shell "dumpsys package $app" | grep "firstInstallTime")

    if [ -n "$installTimeRaw" ]; then
    # Extract just the date string (e.g., 2023-05-12 14:22:01)
    dateString=$(echo "$installTimeRaw" | awk -F'firstInstallTime=' '{print $2}' | xargs)

    # Save the timestamp and app name separated by a tab to the temp file
    echo -e "$dateString\t$app" >> "$tmp_file"
    fi
    fi
    done

    # 3. Sort chronologically, format nicely, and save to the Desktop
    output_file="$HOME/Desktop/installed_apps_ordered.txt"

    echo -e "InstallTime\t\t\tPackageName" > "$output_file"
    sort -n "$tmp_file" >> "$output_file"

    # Clean up temp file
    rm "$tmp_file"

    echo ""
    echo "[+][+][+] Success! Finished Processing [+][+][+]
    echo "File 'installed_apps_ordered.txt' has been saved to your Desktop."
    echo ""
    read -p "Press enter to continue . . ."
    --
    Best includes it does something useful, is free, no ads, no login.
    --- Synchronet 3.22a-Linux NewsLink 1.2
  • From Maria Sophia@mariasophia@comprehension.com to comp.mobile.android,alt.comp.os.windows-10,alt.os.linux on Sun May 31 10:58:50 2026
    From Newsgroup: alt.os.linux

    Maria Sophia wrote:
    Best includes it does something useful, is free, no ads, no login.

    Here's my file of 617 apps I personally installed on my free 64GB A325G.

    If you know of other useful (free, private, no account, no ads) apps not on this list, please let us all know as that's the original goal.

    Have we tested every free useful app on Android by now?
    Dunno.

    I probably tested 5 to 10 times the number of apps that are on my 64GB storage, but here is the current set of 617 apps that I didn't delete.

    PackageName InstallTime
    ----------- -----------
    com.teslacoilsw.launcher 11/1/2022 5:35:16 PM
    org.fdroid.fdroid 11/1/2022 5:42:15 PM
    make.more.r2d2.cellular_z 11/1/2022 7:18:29 PM
    com.duckduckgo.mobile.android 11/1/2022 7:53:58 PM
    com.simplemobiletools.filemanager.pro 11/1/2022 7:55:52 PM
    com.simplemobiletools.gallery.pro 11/1/2022 8:10:35 PM
    pinguin2001.penguingcam 11/1/2022 8:11:21 PM
    org.secuso.privacyfriendlyweather 11/1/2022 8:25:19 PM
    com.google.android.apps.cameralite 11/1/2022 8:26:19 PM
    com.simplemobiletools.voicerecorder 11/1/2022 8:28:44 PM
    com.simplemobiletools.calculator 11/1/2022 8:30:01 PM
    com.simplemobiletools.calendar.pro 11/1/2022 8:30:08 PM
    com.simplemobiletools.camera 11/1/2022 8:30:15 PM
    org.secuso.privacyfriendlytodolist 11/1/2022 8:46:25 PM
    org.secuso.privacyfriendlyfoodtracker 11/1/2022 8:46:45 PM
    com.theolivetree.webdavserver 11/1/2022 8:47:09 PM
    com.mixplorer 11/1/2022 8:47:30 PM
    eu.faircode.email 11/1/2022 8:47:46 PM
    com.sovworks.edslite 11/1/2022 8:47:55 PM
    com.zq.webdav.app_free 11/1/2022 8:48:07 PM
    com.aurora.adroid 11/1/2022 9:01:13 PM
    com.Avenza 11/1/2022 9:01:30 PM
    com.simplemobiletools.clock 11/1/2022 9:13:16 PM
    com.simplemobiletools.draw.pro 11/1/2022 9:16:41 PM
    com.simplemobiletools.musicplayer 11/1/2022 9:16:57 PM
    com.simplycomplexapps.ASTellme 11/1/2022 10:06:44 PM
    com.elitecrest.orenda 11/1/2022 10:14:05 PM
    com.wilysis.cellinfolite 11/2/2022 10:29:43 AM
    com.i45.launchdialer 11/2/2022 8:25:41 PM
    com.goodwy.contacts 11/2/2022 8:32:09 PM
    com.simplemobiletools.contacts.pro 11/3/2022 9:58:08 PM
    com.danielkim.soundrecorder 11/3/2022 9:59:51 PM
    nextapp.fx 11/4/2022 10:37:05 AM
    pl.mkexplorer.kormateusz 11/4/2022 2:47:26 PM
    com.amaze.filemanager 11/4/2022 2:49:25 PM
    flar2.devcheck 11/5/2022 7:30:53 AM
    ru.andr7e.deviceinfohw 11/5/2022 7:33:02 AM
    org.secuso.privacyfriendlyactivitytracker 11/5/2022 8:11:52 PM
    maderski.chargingindicator 11/5/2022 8:12:19 PM
    com.reneph.passwordsafe 11/17/2022 7:32:25 PM
    com.better.alarm 11/19/2022 6:20:30 PM
    com.hudun.androidrecorder 11/19/2022 6:25:26 PM
    com.sayhi.android.sayhitranslate 11/19/2022 6:27:23 PM
    com.geekyouup.android.ustopwatch 11/19/2022 7:32:33 PM
    ws.xsoh.etar 11/19/2022 7:56:28 PM
    com.keuwl.sandtimer 11/19/2022 7:59:51 PM
    com.keuwl.spiritlevel 11/19/2022 8:21:48 PM
    com.keuwl.stopwatch 11/19/2022 8:22:20 PM
    com.keuwl.protractor 11/19/2022 8:24:18 PM
    com.keuwl.ruler 11/19/2022 8:25:04 PM
    com.simplemobiletools.dialer 11/19/2022 8:44:01 PM
    me.tsukanov.counter 11/19/2022 8:49:54 PM
    com.starikov.datecalc 11/19/2022 8:52:01 PM
    com.mta.countdown 11/19/2022 9:01:42 PM
    com.lonelycatgames.Xplore 11/20/2022 10:50:26 AM
    org.aospstudio.files 11/20/2022 10:53:20 AM
    com.nitish.privacyindicator 11/20/2022 6:51:06 PM
    com.parsed.securitywall 11/20/2022 6:53:20 PM
    com.lexa.fakegps 11/20/2022 9:37:20 PM
    ru.perm.trubnikov.gps2sms 11/20/2022 9:56:32 PM
    com.sharpitor.nightsky20 11/20/2022 10:14:03 PM
    com.noctuasoftware.stellarium_free 11/20/2022 10:14:20 PM
    com.lavadip.skeye 11/20/2022 10:14:33 PM
    de.alcyone.livestarchart 11/20/2022 10:23:46 PM
    com.google.android.stardroid 11/20/2022 10:24:16 PM
    com.phg.constellations 11/20/2022 10:25:43 PM
    org.dslul.openboard.inputmethod.latin 11/21/2022 8:20:32 AM
    com.darshancomputing.BatteryIndicatorPro 11/22/2022 5:27:09 PM
    com.asksven.betterbatterystats 11/22/2022 5:27:54 PM
    com.arachnoid.sshelper 11/25/2022 8:41:59 AM
    org.galexander.sshd 11/25/2022 9:44:29 AM
    com.trelleborg.tss.avc 11/25/2022 9:47:12 AM
    uno.platform.calculator 11/25/2022 9:47:55 AM
    cisterna.promo 11/25/2022 9:50:02 AM
    com.sumeet.areavolumecalculator 11/25/2022 9:50:29 AM
    com.krengr.wpc 11/25/2022 9:50:41 AM
    keepass2android.keepass2android 12/3/2022 10:54:08 AM
    com.illusion.checkfirm 12/6/2022 12:05:59 PM
    com.topjohnwu.magisk 12/6/2022 2:19:08 PM
    com.rom1v.sndcpy 12/7/2022 3:53:51 PM
    org.catrobat.paintroid 12/21/2022 1:23:54 PM
    com.mobivio.android.cutecut 12/21/2022 1:36:16 PM
    com.shallwaystudio.nodevideo 12/21/2022 1:37:35 PM
    com.niksoftware.snapseed 12/21/2022 1:43:16 PM
    com.dsphotoeditor.demoapp 12/21/2022 5:54:06 PM
    co.inker 12/21/2022 5:55:27 PM
    com.amaze.fileutilities 12/21/2022 6:20:34 PM
    com.gsamlabs.bbm 12/24/2022 3:51:38 PM
    com.sec.android.easyMover 12/25/2022 6:46:15 PM
    ca.abbro.androidmap 12/28/2022 8:56:47 PM
    mobi.maptrek 12/29/2022 12:52:32 AM
    mobi.maptrek.lite 12/29/2022 12:52:52 AM
    com.custommapsapp.android 12/29/2022 12:54:50 AM
    com.vonglasow.michael.satstat 12/29/2022 12:57:09 AM
    ro.overwrite.azimuthcompass 12/29/2022 12:57:47 AM
    eu.basicairdata.graziano.gpslogger 12/29/2022 12:58:27 AM
    net.osmtracker 12/29/2022 12:59:00 AM
    de.dennisguse.opentracks 12/29/2022 1:10:54 AM
    com.generalmagic.magicearth 12/29/2022 1:12:05 AM
    com.kylecorry.trail_sense 12/29/2022 1:19:46 AM
    net.psyberia.offlinemaps 12/29/2022 1:21:26 AM
    org.ssandon.altimeter 12/29/2022 3:37:30 AM
    com.hoehenmesser.cjp 12/29/2022 3:38:23 AM
    org.efalk.altimeter 12/29/2022 3:38:35 AM
    com.gpspleinair.sunmoontime 12/29/2022 9:23:07 AM
    com.idle.sunboard 12/29/2022 9:24:24 AM
    com.google.earth 12/29/2022 9:24:53 AM
    com.accuweather.android 12/29/2022 9:42:11 AM
    info.vazquezsoftware.weatheralarms 12/29/2022 9:46:04 AM
    com.windhub.marine.weather 12/29/2022 9:51:57 AM
    co.windyapp.android 12/29/2022 9:53:56 AM
    com.windyty.android 12/29/2022 9:55:54 AM
    com.android.gpstest.osmdroid 1/7/2023 7:12:55 AM
    com.trailheadlabs.outerspatial 1/16/2023 12:00:06 AM
    com.unagit.parkedcar 1/18/2023 1:14:38 AM
    com.llamalab.automate 1/18/2023 3:53:52 AM
    com.keuwl.gpswaypoints 1/24/2023 12:50:20 PM
    com.keuwl.compass 1/24/2023 1:49:42 PM
    com.keuwl.eggtimer 1/24/2023 1:53:15 PM
    com.discipleskies.aaafindmycar 1/27/2023 7:46:02 PM
    eu.faircode.netguard 2/8/2023 3:29:07 PM
    org.bromite.bromite 2/11/2023 12:07:00 PM
    org.bromite.chromium 2/11/2023 12:17:36 PM
    com.github.yeriomin.yalpstore 2/11/2023 12:22:33 PM
    org.torproject.torbrowser 2/11/2023 1:14:47 PM
    com.epic.browser 2/11/2023 1:20:16 PM
    com.applaudsoft.wabi.wad 2/11/2023 1:59:34 PM
    com.github.axet.audiorecorder 2/21/2023 5:16:49 PM
    com.dimowner.audiorecorder 2/21/2023 5:22:35 PM
    com.sec.android.app.voicenote 2/21/2023 5:31:48 PM
    net.nitroshare.android 2/23/2023 4:08:55 PM
    in.yourstreet.permissionmanager 2/24/2023 8:14:32 AM
    com.termux 3/1/2023 12:30:17 PM
    com.tools.netgel.netx 3/5/2023 12:52:52 AM
    org.asdtm.goodweather 3/9/2023 1:25:45 AM
    com.orgzly 3/9/2023 1:37:59 AM
    com.adrianmejia.calculator 3/9/2023 1:43:31 AM
    com.apkupdater 3/9/2023 1:55:09 AM
    org.dmfs.tasks 3/9/2023 2:01:56 AM
    is.xyz.mpv 3/9/2023 2:04:40 AM
    org.courville.nova 3/9/2023 2:05:49 AM
    com.veewalabs.unitconverter 3/12/2023 10:58:23 AM
    net.smartlogic.unitconverter 3/12/2023 10:59:40 AM
    com.mobitrendz.unitconverters 3/12/2023 11:02:25 AM
    yellowtreesoftware.usconverter 3/12/2023 11:06:44 AM
    com.convertbee 3/12/2023 11:12:07 AM
    org.kp.tpmg.preventivecare 3/14/2023 4:14:24 PM
    deckers.thibault.aves 3/19/2023 8:14:38 PM
    com.hanan.android.ramkol 3/31/2023 7:00:15 PM
    com.draco.ladb 3/31/2023 9:11:06 PM
    com.giga_recorderapp.callrecording 4/5/2023 1:23:45 PM
    com.balda.intenttask 4/5/2023 9:27:04 PM
    rk.android.app.shortcutmaker 4/5/2023 9:27:20 PM
    de.szalkowski.activitylauncher 4/5/2023 9:28:03 PM
    com.deltacdev.websiteshortcut 4/5/2023 9:28:49 PM
    com.alextern.shortcuthelper 4/5/2023 9:30:25 PM
    com.cemique.shortcutwidgets 4/5/2023 9:32:47 PM
    ussr.razar.inspector 4/5/2023 9:33:54 PM
    de.halfreal.clipboardactions 4/17/2023 3:10:36 PM
    at.bitfire.davdroid 5/11/2023 11:56:48 PM
    me.billdietrich.fake_contacts 5/27/2023 12:05:55 AM
    org.sufficientlysecure.localcalendar 5/27/2023 1:23:26 AM
    com.cardsapp.android 5/31/2023 2:57:29 PM
    com.google.zxing.client.android 6/1/2023 6:47:01 PM
    com.manateeworks.barcodescanners 6/1/2023 6:51:56 PM
    com.srowen.bs.android 6/1/2023 7:09:14 PM
    com.blogspot.aeioulabs.barcode 6/1/2023 7:16:00 PM
    barcodescanner.qrscanner 6/4/2023 8:38:44 PM
    com.scanteam.qrcodereader 6/4/2023 8:40:16 PM
    com.aitorguascone.myamsler 6/6/2023 11:01:09 PM
    com.keuwl.wifi 6/6/2023 11:40:53 PM
    org.vosk.demo 6/6/2023 11:49:48 PM
    vsin.t16_funny_photo 6/28/2023 4:04:58 PM
    com.photoroom.app 6/28/2023 4:17:20 PM
    com.lyrebirdstudio.toonart 6/28/2023 4:18:26 PM
    com.vicman.toonmeapp 6/28/2023 4:18:59 PM
    gr.gamebrain.comica 6/28/2023 4:20:34 PM
    com.gamebrain.cartoon 6/28/2023 4:24:54 PM
    cz.psencik.com.android.contacts 7/3/2023 10:55:25 PM
    opencontacts.open.com.opencontacts 7/4/2023 9:12:08 PM
    cz.mroczis.netmonster 7/14/2023 11:22:17 AM
    com.git.trailcamerapro2 7/29/2023 7:16:29 PM
    com.geeksville.mesh 8/4/2023 11:17:58 PM
    com.neuracle.zulutime 8/26/2023 5:43:36 AM
    pixer.worldclock 8/26/2023 5:44:46 AM
    com.chibatching.worldclockwidget 8/26/2023 5:48:02 AM
    app.easyworldclock 8/26/2023 5:48:28 AM
    nz.co.impressioncreative.timezone_viewer 8/26/2023 5:53:26 AM
    com.savvytime.mobile 8/26/2023 5:53:51 AM
    com.floraincognita.app.floraincognita 8/26/2023 5:58:27 AM
    com.scaleup.plantid 8/26/2023 6:01:00 AM
    org.plantnet 8/26/2023 6:08:55 AM
    org.inaturalist.seek 8/26/2023 6:12:21 AM
    com.ghostery.android.ghostery 8/29/2023 11:34:07 PM
    com.vrem.wifianalyzer 9/5/2023 10:50:21 PM
    com.ubnt.usurvey 9/5/2023 10:51:04 PM
    ru.andr7e.wifimonitor 9/5/2023 10:52:48 PM
    com.etwok.netspotapp 9/5/2023 10:54:56 PM
    com.manageengine.wifimonitor 9/5/2023 11:32:16 PM
    net.simplyadvanced.ltediscovery 9/5/2023 11:33:33 PM
    aws.apps.networkInfoIi 9/5/2023 11:37:24 PM
    com.tts.imnos_mobile 9/6/2023 12:01:23 AM
    com.novvia.fispy 9/6/2023 3:37:13 AM
    jp.miotti.ShortcutToURL 9/6/2023 8:52:59 PM
    com.panagola.app.shortcut 9/6/2023 8:53:56 PM
    rk.android.app.pinnedshortcuts 9/6/2023 8:56:34 PM
    com.leedroid.shortcutter 9/6/2023 8:58:09 PM
    com.sika524.android.quickshortcut 9/6/2023 9:18:47 PM
    com.momocode.shortcuts 9/6/2023 9:18:59 PM
    com.bhanu.appshortcutmaker 9/6/2023 9:20:24 PM
    any.shortcut 9/6/2023 9:21:02 PM
    com.kodarkooperativet.notificationstopwatch 9/6/2023 10:10:37 PM
    org.openintents.filemanager 9/6/2023 10:11:12 PM
    de.avm.android.wlanapp 9/6/2023 10:11:58 PM
    org.craigslist.CraigslistMobile 9/6/2023 10:43:31 PM
    krow.dev.scheme 9/7/2023 10:00:33 AM
    com.villevalta.intentlauncher 9/7/2023 10:29:16 AM
    com.trianguloy.instantintent 9/7/2023 10:30:52 AM
    com.cunnj.activitylauncher 9/7/2023 10:32:31 AM
    info.maigo.lab.intentviewer 9/7/2023 10:33:50 AM
    com.darshancomputing.BatteryIndicator 9/9/2023 12:24:10 AM
    net.braincake.pixl.pixl 9/10/2023 10:59:26 AM
    gov.caltrans.quickmap 9/10/2023 11:59:04 AM
    com.adamsappls.carc 9/10/2023 12:05:17 PM
    com.jndapp.lux.free.iconpack 9/10/2023 10:14:38 PM
    com.whicons.iconpack 9/10/2023 10:40:43 PM
    org.fdroid.basic 9/12/2023 2:17:51 PM
    twoxmars.packagenameviewer 9/12/2023 11:09:45 PM
    cz.seeq.prog.android.packageviewer 9/12/2023 11:31:59 PM
    com.csdroid.pkg 9/12/2023 11:32:51 PM
    com.PDquila.HiddenSettings 9/12/2023 11:57:26 PM
    org.vndnguyen.shortcutmaster.lite 9/12/2023 11:59:36 PM
    com.activitymanager 9/13/2023 12:06:15 AM
    scadica.prcl 9/13/2023 8:27:20 AM
    com.ubqsoft.sec01 9/14/2023 9:06:43 AM
    com.codex.appinspector 9/14/2023 9:08:53 AM
    com.jarsilio.android.scrambledeggsif 9/14/2023 9:12:07 AM
    com.srjuen.exifviewer 9/14/2023 9:13:13 AM
    com.none.tom.exiferaser 9/14/2023 9:14:56 AM
    com.photograph.editexifphoto 9/14/2023 9:15:43 AM
    com.aminbeheshti.exifviewer 9/14/2023 10:01:20 AM
    flar2.homebutton 9/15/2023 10:38:20 PM
    io.github.sds100.keymapper 9/15/2023 11:15:08 PM
    com.agence3pp.euroconsumers 9/16/2023 10:53:24 AM
    com.rasfar.mock.location 9/20/2023 7:20:36 PM
    com.discipleskies.mock_location_spoofer 9/20/2023 8:46:38 PM
    com.mock.cartage 9/20/2023 9:01:26 PM
    fake.gps.location.changer.spoof.location 9/20/2023 9:10:36 PM
    com.bomerapps.movablemockgps 9/20/2023 9:13:51 PM
    org.mozilla.firefox 9/21/2023 8:06:23 PM
    com.rsupport.rs.activity.rsupport.aas2 9/22/2023 10:08:33 AM
    com.apk.editor 10/6/2023 11:11:25 PM
    org.bromite.webview 10/7/2023 1:15:24 AM
    tk.hack5.treblecheck 10/8/2023 1:18:58 AM
    com.oF2pks.applicationsinfo 10/9/2023 12:51:08 PM
    com.smartpack.packagemanager 10/9/2023 1:16:48 PM
    de.dieterthiess.contactdiary2 10/14/2023 6:10:29 AM
    com.tasomaniac.openwith 10/14/2023 7:20:24 PM
    fr.smarquis.applinks 10/14/2023 8:08:16 PM
    net.sourceforge.opencamera 10/15/2023 1:05:02 AM
    scadica.aq 10/15/2023 1:08:29 AM
    de.hskl.contacts 10/15/2023 1:19:43 PM
    am.ed.exportcontacts 10/15/2023 1:21:32 PM
    am.ed.importcontacts 10/15/2023 1:22:11 PM
    com.github.tmo1.sms_ie 10/15/2023 1:23:20 PM
    net.stargw.contactsimport 10/15/2023 1:25:57 PM
    cx.vmx.sdcontacts 10/15/2023 1:41:55 PM
    de.ritscher.simplemobiletools.contacts.pro 10/15/2023 2:15:19 PM
    hazar.studio.privatecontacts 10/15/2023 2:54:55 PM
    ch.abwesend.privatecontacts 10/16/2023 5:55:04 AM
    com.compelson.optimizer 10/17/2023 11:22:28 PM
    ch.protonmail.android 10/23/2023 12:12:59 AM
    com.nextcloud.client 10/27/2023 10:50:32 PM
    ninja.sesame.app.edge 11/1/2023 12:06:55 PM
    com.macca895.sunriise 11/2/2023 7:57:39 AM
    com.forrestguice.suntimeswidget 11/2/2023 8:04:33 AM
    com.forrestguice.suntimescalendars 11/2/2023 8:05:10 AM
    com.bnyro.clock 11/2/2023 8:15:34 AM
    com.agnibho.android.solarcompass 11/2/2023 8:29:29 AM
    com.github.ruleant.getback_gps 11/2/2023 8:33:17 AM
    com.zoffcc.applications.zanavi 11/2/2023 8:34:56 AM
    com.oasisfeng.island.fdroid 11/6/2023 2:28:55 AM
    com.airbeat.device.inspector 11/6/2023 11:47:47 PM
    fm.a2d.sf 11/13/2023 12:35:31 PM
    com.liveradio.fmradio.radiotuner.radiostation.amradio 11/13/2023 2:35:00 PM
    com.yuriy.openradio 11/13/2023 2:36:11 PM
    com.pas.webcam 11/15/2023 11:43:47 PM
    com.jairaj.janglegmail.motioneye 11/16/2023 12:25:18 AM
    dk.mvainformatics.android.motiondetectorpro.activity 11/16/2023 8:20:24 AM
    com.jght.jgcam 11/18/2023 3:31:59 AM
    com.jacksoftw.webcam 11/18/2023 3:59:13 AM
    com.fineshare.finecam 11/18/2023 4:02:32 AM
    com.messages.chat 11/22/2023 2:02:24 AM
    com.beeper.chat 11/22/2023 2:17:34 AM
    com.nll.store 11/25/2023 10:34:37 AM
    com.nll.helper 11/25/2023 10:39:18 AM
    com.nll.asr 11/25/2023 10:41:54 AM
    org.mozilla.focus 11/26/2023 8:33:26 PM
    com.trianguloy.openInWhatsapp 11/27/2023 7:29:24 AM
    com.applaudsoft.wabi.virtual_number 11/27/2023 7:31:56 AM
    com.simplemobiletools.flashlight 12/5/2023 12:45:17 AM
    com.simplemobiletools.keyboard 12/5/2023 12:46:17 AM
    com.simplemobiletools.notes.pro 12/5/2023 12:47:06 AM
    com.simplemobiletools.smsmessenger 12/5/2023 12:47:25 AM
    com.urbandroid.inline 12/13/2023 7:03:48 AM
    com.blueline.signalchecklite 12/20/2023 9:05:36 PM
    com.cbfs.cbfscellidtracker 12/20/2023 9:14:38 PM
    com.applications.xas.obdultra 12/21/2023 12:01:16 AM
    com.chinhlqtb.elm327.obd2.terminal 12/21/2023 12:02:45 AM
    com.clickshopping.obddiagscan 12/21/2023 12:03:56 AM
    it.smartapps4me.smartcontrol 12/21/2023 12:05:18 AM
    pl.ccy.ccyobdmobile 12/21/2023 12:07:05 AM
    com.obd2 12/21/2023 12:08:02 AM
    com.obd2.research 12/21/2023 12:08:58 AM
    com.vchecker.x_elm 12/21/2023 12:09:48 AM
    com.konart.obd.dashboardRacing 12/21/2023 12:10:38 AM
    se.infocar.icardtc 12/21/2023 12:11:30 AM
    com.autoxuga.diagnosisobd 12/21/2023 12:12:13 AM
    com.autoxuga.obd 12/21/2023 12:13:41 AM
    com.Go.EngModeMtkShortcut 12/21/2023 3:48:05 AM
    com.mtkeng.anubhavraj.mtkengineermode 12/21/2023 3:49:27 AM
    com.princewellinc.supermtkengineering 12/21/2023 3:49:47 AM
    org.prowl.torquefree 12/22/2023 11:43:52 AM
    com.junkfood.seal 12/29/2023 1:33:20 PM
    com.evo.inware 1/4/2024 11:34:35 PM
    com.kgurgul.cpuinfo 1/4/2024 11:35:43 PM
    org.coolreader 1/4/2024 11:58:56 PM
    com.javiersantos.mlmanager 1/5/2024 1:27:42 AM
    com.isaiasmatewos.texpand 1/5/2024 7:34:51 PM
    org.consumerreports.permissionslip.production 1/6/2024 8:28:00 PM
    de.maza.zpush 1/6/2024 9:12:50 PM
    tiar.ua.slf 1/6/2024 9:24:07 PM
    net.cozic.joplin 1/6/2024 9:42:42 PM
    com.smestorage 1/6/2024 9:44:37 PM
    com.checkboxtasksapp.android 1/6/2024 9:55:12 PM
    com.runitrut.dailytodoapp 1/6/2024 9:59:42 PM
    com.ctoad.android.DoBe2 1/6/2024 10:04:49 PM
    com.Naina.Inc.getDone 1/6/2024 10:06:57 PM
    com.mayaal.todo 1/6/2024 10:18:28 PM
    rakta.tech.todotasklist.doitnow 1/6/2024 10:20:54 PM
    de.darko.todo_list 1/6/2024 11:13:34 PM
    at.ff.outliner 1/6/2024 11:16:08 PM
    com.pdr.android.apps.mylogs 1/6/2024 11:19:19 PM
    com.ash.fly 1/6/2024 11:22:45 PM
    com.wordpress.khatrirohan.mytodonote 1/6/2024 11:25:17 PM
    com.linsam.apps.android.flexilists.pro 1/6/2024 11:41:41 PM
    com.microsoft.todos 1/6/2024 11:45:15 PM
    tuple.me.dtools 1/11/2024 7:13:44 PM
    ch.martinstoeckli.silentnotes 1/15/2024 9:17:31 PM
    com.ghostsq.commander.https 1/16/2024 1:13:56 AM
    com.ghostsq.commander 1/16/2024 1:31:35 AM
    com.ghisler.android.TotalCommander 1/16/2024 12:47:35 PM
    com.ghisler.tcplugins.WebDAV 1/16/2024 12:50:36 PM
    com.ghisler.tcplugins.LAN 1/16/2024 12:51:48 PM
    ml.bluelinestudio.privatecontact 1/18/2024 3:18:21 AM
    com.syndoc.merlin 1/26/2024 6:04:30 PM
    ru.zdevs.zarchiver 1/26/2024 6:20:11 PM
    shareit.lite 1/26/2024 6:50:36 PM
    de.srlabs.snoopsnitch 1/28/2024 2:09:44 PM
    com.stoutner.privacycell 1/28/2024 2:11:21 PM
    com.skibapps.cellspycatcher 1/28/2024 2:15:37 PM
    com.nutomic.syncthingandroid 1/31/2024 9:10:18 PM
    com.legalimpurity.rsync 2/1/2024 1:36:22 PM
    org.amoradi.syncopoli 2/2/2024 12:39:30 AM
    com.airvisual 2/5/2024 1:27:21 AM
    mobile.application.forfree.earth 2/5/2024 1:30:58 AM
    com.myuniportal.android.apps.airwildfirelocationsnow 2/5/2024 1:37:19 AM
    com.davidgrossapps.wildfire 2/5/2024 3:06:37 AM
    com.la.local.weather.forecast.app 2/5/2024 3:13:06 AM
    com.lholman.hiweather 2/5/2024 3:19:36 AM
    aerow.us.aerowind 2/5/2024 3:22:53 AM
    ca.cmetcalfe.locationshare 2/5/2024 3:45:55 AM
    com.device_context.stepsmagic_free 2/5/2024 3:47:33 AM
    com.main.contacts.smsmanager 2/5/2024 4:00:45 AM
    com.safetyapp.b.safe.emergencyapp 2/5/2024 4:08:50 AM
    no.nrk.yr 2/5/2024 4:35:40 AM
    org.androworks.klara 2/5/2024 4:46:50 AM
    com.neverads.just_weather 2/5/2024 4:54:21 AM
    uk.co.openweather 2/5/2024 4:56:50 AM
    com.alexplas.weathernew 2/5/2024 5:02:13 AM
    com.sideline.phone.number 2/8/2024 7:26:33 PM
    me.number.app.im 2/8/2024 8:03:57 PM
    com.cbs.app 2/11/2024 1:08:13 AM
    com.cbs.tve 2/11/2024 1:17:10 AM
    de.pfattner.speedo.android 2/24/2024 7:06:42 PM
    com.lcxventures.gpxlab.app 2/24/2024 7:18:46 PM
    com.eschuenemann.outdoorsportscompanion 2/24/2024 7:20:07 PM
    com.jordiboixadera.trailGuide 2/24/2024 7:21:58 PM
    com.earth.explorer 2/24/2024 7:23:30 PM
    com.DjangoLaunchpad.Sondel_Buddy 2/24/2024 7:25:00 PM
    ch.opengis.qfield 2/25/2024 1:40:47 AM
    org.openorienteering.mapper 2/25/2024 1:45:57 AM
    com.wolfgangknecht.sketchatrack 2/25/2024 1:48:52 AM
    com.halfmilelabs.footpath 2/25/2024 1:52:34 AM
    pl.nwg.dev.rambler.gpx 2/25/2024 1:56:13 AM
    com.technomadapps.gpsalarm 2/25/2024 10:23:32 AM
    dev.imranr.obtainium 2/27/2024 8:36:14 AM
    org.woheller69.weather 2/27/2024 12:01:22 PM
    sk.styk.martin.apkanalyzer 2/28/2024 12:48:58 AM
    com.casraq.android.apksignaturechecker 2/28/2024 12:54:13 AM
    com.app.detail 2/28/2024 1:24:22 AM
    com.update.software.updateallapps 2/28/2024 1:55:56 AM
    net.muik.myappfinder 2/28/2024 3:23:23 AM
    com.spencerstudios.applist 2/28/2024 3:23:32 AM
    de.onyxbits.listmyapps 2/28/2024 3:25:09 AM
    krow.dev.addetector 2/28/2024 3:27:50 AM
    com.quad9.aegis 3/6/2024 11:52:32 PM
    com.maxistar.textpad 3/8/2024 9:42:48 AM
    com.adobe.reader 3/15/2024 6:47:18 PM
    pdf.pdfreader.pdfviewer.reader.officelens 3/15/2024 6:47:44 PM
    com.urbandroid.dontkillmyapp 3/18/2024 10:14:48 AM
    me.piebridge.brevent 3/18/2024 10:17:34 AM
    org.codedrink.app_killer 3/18/2024 10:19:40 AM
    com.redsoft.zerocleaner 3/18/2024 10:44:13 AM
    com.github.bmx666.appcachecleaner.googleplay 3/18/2024 10:50:01 AM
    com.symantec.cleansweep 3/18/2024 10:51:10 AM
    com.cybercat.acbridge 3/20/2024 1:17:27 AM
    com.bikegpx 3/21/2024 11:06:43 PM
    com.rungo 3/21/2024 11:08:21 PM
    com.vecturagames.android.app.gpxviewer 3/21/2024 11:12:06 PM
    OziExplorer.Main 3/22/2024 3:58:20 PM
    com.toralabs.deviceinfo 3/25/2024 1:12:20 AM
    com.apps.settings 3/25/2024 1:19:44 AM
    com.netvor.settings.database.editor 3/25/2024 1:28:09 AM
    com.netvor.settings.database.provider 3/25/2024 1:30:42 AM
    com.apple.trackerdetect 3/30/2024 10:34:38 PM
    com.twiegold.atomictime 4/3/2024 12:00:26 PM
    com.overlook.android.fing 4/7/2024 8:07:22 PM
    kik.android 4/23/2024 6:15:03 PM
    com.droidvim 4/27/2024 7:04:19 PM
    de.seemoo.at_tracking_detection.release 5/1/2024 7:56:46 AM
    mod.piaohong.newsgroup 5/2/2024 9:39:08 AM
    com.syncitgroup.android.iamhere 5/3/2024 6:45:13 AM
    com.loves.finder 5/17/2024 2:52:02 PM
    com.fmsys.snapdrop 5/22/2024 12:33:31 PM
    com.neure.anddrop 5/22/2024 12:35:59 PM
    com.maforn.timedshutdown 5/25/2024 5:46:31 PM
    ru.gavrikov.mocklocations 5/26/2024 11:23:44 AM
    com.sybu.imageresizer 5/26/2024 5:54:08 PM
    com.github.axet.bookreader 5/27/2024 9:19:46 PM
    com.gzhi.neoreader.r2.main.free 5/28/2024 11:13:00 AM
    com.kevinzuccaro.epubreader 5/28/2024 11:16:49 AM
    org.readera 5/28/2024 11:19:11 AM
    com.sigseg.android.worldmap 5/28/2024 2:59:04 PM
    de.topobyte.apps.bms.atlas 5/28/2024 3:02:36 PM
    superfreeze.tool.android 5/28/2024 9:10:29 PM
    org.cromite.cromite 5/28/2024 11:37:06 PM
    app.grapheneos.camera 5/28/2024 11:38:20 PM
    com.atharok.barcodescanner 5/28/2024 11:40:35 PM
    org.solovyev.android.calculator 5/28/2024 11:43:11 PM
    com.jens.automation2 5/28/2024 11:44:31 PM
    wangdaye.com.geometricweather 5/28/2024 11:47:23 PM
    com.yuanfang2345.passport 5/29/2024 8:55:06 AM
    ai.chat.gpt.app 5/29/2024 11:40:25 AM
    com.beemdevelopment.aegis 5/29/2024 11:47:10 PM
    com.iboism.gpxrecorder 6/2/2024 2:44:41 PM
    com.iboism.dictate 6/2/2024 2:48:29 PM
    com.bundle.anchor 6/2/2024 3:01:03 PM
    com.mschloapps.basicgps 6/2/2024 3:10:14 PM
    com.app.compass.finddirection.digitalcompass.gpsutils.gpscompass 6/2/2024 3:19:57 PM
    org.primeit.compass 6/2/2024 3:22:09 PM
    com.momo.fakegps.locationchanger 6/2/2024 3:23:19 PM
    com.tiptop.ai.chat.gpt 6/4/2024 1:21:17 AM
    no.nordicsemi.android.mcp 6/4/2024 9:20:13 PM
    com.looker.droidify 6/4/2024 10:32:35 PM
    f.cking.software 6/4/2024 10:54:51 PM
    com.mirfatif.mylocation 6/4/2024 10:59:08 PM
    com.emacberry.gpslogger 6/5/2024 10:22:36 PM
    com.atolphadev.quikshort 6/10/2024 11:22:58 AM
    com.alextern.shortcutexecutors 6/11/2024 10:21:50 PM
    jp.miotti.AndroidViewer 6/11/2024 11:33:20 PM
    sarangal.packagemanager 6/11/2024 11:40:40 PM
    com.celzero.bravedns 6/12/2024 9:50:14 AM
    net.stargw.fok 6/14/2024 3:52:53 PM
    helium314.keyboard 6/17/2024 9:24:41 AM
    com.aurora.store 6/18/2024 6:50:16 PM
    com.teamviewer.teamviewer.market.mobile 6/18/2024 6:52:44 PM
    com.teamviewer.quicksupport.market 6/18/2024 8:01:16 PM
    com.sand.airsos 6/18/2024 8:05:32 PM
    com.sand.remotesupportaddon 6/18/2024 8:07:49 PM
    com.sand.aircast 6/18/2024 8:08:51 PM
    com.teamviewer.host.market 6/18/2024 8:10:28 PM
    com.teamviewer.pilot 6/18/2024 8:11:42 PM
    com.teamviewer.quicksupport.addon.universal 6/18/2024 8:12:29 PM
    com.teamviewer.blizz.market 6/18/2024 8:13:39 PM
    com.mirfatif.permissionmanagerx 6/22/2024 7:05:02 PM
    com.nbcnews.msnbc.mobile 7/5/2024 8:31:45 AM
    org.schabi.newpipe 7/10/2024 6:03:32 PM
    com.duns.padiapp 7/27/2024 8:39:18 PM
    com.github.olga_yakovleva.rhvoice.android 7/28/2024 5:43:31 AM
    com.unitconverterpro.ucplite 8/3/2024 8:17:51 PM
    de.blinkt.openvpn 8/4/2024 10:14:51 AM
    net.openvpn.openvpn 8/4/2024 3:03:00 PM
    com.secuso.privacyFriendlyCodeScanner 8/12/2024 4:17:45 PM
    krow.dev.qrcode 8/12/2024 4:19:29 PM
    InfinityLoop1309.NewPipeEnhanced 8/14/2024 3:44:50 PM
    com.mobilityware.solitaire 8/24/2024 7:47:14 AM
    com.fiistudio.fiinote 9/1/2024 8:25:43 PM
    ru.tech.imageresizershrinker 9/2/2024 9:39:17 AM
    de.th.suncalcorg 9/10/2024 5:35:48 PM
    com.ratana.sunsurveyorlite 9/10/2024 5:41:26 PM
    de.th.mooncalcorg 9/13/2024 3:45:08 PM
    com.pw.wifishortcut 9/14/2024 9:47:25 PM
    moe.shizuku.privileged.api 9/14/2024 9:57:01 PM
    be.casperverswijvelt.unifiedinternetqs 9/14/2024 10:14:47 PM
    com.amtrak.rider 9/15/2024 3:09:28 PM
    com.passportphoto.visaid.photomaker 9/18/2024 5:19:53 PM
    com.darkgalaxy.client.app_id_photo 9/18/2024 5:22:05 PM
    com.pixlr.removebg 9/18/2024 7:41:06 PM
    photo.editor.background.eraser 9/18/2024 8:03:31 PM
    com.photo.editor.square.pic.splash 9/18/2024 8:17:14 PM
    photo.editor.background.eraser.blend.pic 9/18/2024 9:10:59 PM
    de.felixnuesse.extract 9/22/2024 11:18:38 AM
    us.zoom.videomeetings 9/24/2024 4:25:56 PM
    com.heleron.wifiroamingfix 9/29/2024 5:05:16 PM
    com.solarpanelcalculator.ZishanAdThandar 9/30/2024 10:12:19 PM
    io.simplicity.trainspotting 10/13/2024 4:32:13 PM
    com.juanvision.eseecloud30 10/16/2024 11:01:10 PM
    com.skyjos.apps.fileexplorerfree 10/26/2024 2:38:54 PM
    com.cloudedge.smarteye 11/1/2024 8:39:04 PM
    com.intsig.cspdf 11/4/2024 2:14:53 PM
    asav.roomtemperature.us 11/23/2024 1:06:20 AM
    com.pilot51.voicenotify 1/12/2025 11:04:52 PM
    org.schabi.newpipe.debug 1/21/2025 5:57:13 PM
    com.yoshi.rain 1/27/2025 11:01:00 PM
    com.brunopiovan.avozdazueira 2/17/2025 5:04:58 AM
    com.cliffweitzman.speechify2 2/17/2025 6:36:38 AM
    ai.articlereader.mobileapp 2/17/2025 7:41:14 AM
    hesoft.T2S 2/17/2025 9:04:11 AM
    com.codespaceapps.listeningapp 2/17/2025 9:06:00 AM
    com.stcodesapp.text2speech 2/17/2025 11:45:09 AM
    com.alpaca.android.readout 2/17/2025 11:48:10 AM
    io.elevenlabs.readerapp 2/18/2025 11:12:31 PM
    com.hyperionics.avar 2/18/2025 11:48:09 PM
    com.ktix007.talk 2/19/2025 12:00:04 AM
    rb.camere 2/19/2025 12:08:27 AM
    com.ifeanyi.read 2/19/2025 12:11:34 AM
    com.finalwire.aida64 3/20/2025 11:21:31 PM
    com.cpuid.cpu_z 3/21/2025 3:55:53 PM
    org.localsend.localsend_app 4/8/2025 4:31:19 AM
    net.nirsoft.wificollector 5/14/2025 12:48:05 AM
    com.ytheekshana.deviceinfo 5/19/2025 8:31:20 AM
    com.pixplicity.devcheck 5/19/2025 8:39:08 AM
    org.uguess.android.sysinfo.pro 5/19/2025 9:02:31 AM
    org.uguess.android.sysinfo 5/19/2025 10:16:48 AM
    com.trixels.deviceinfo 5/19/2025 10:16:56 AM
    com.evilscan.deviceinfo 5/19/2025 10:27:45 AM
    app.accrescent.client 5/21/2025 11:03:30 PM
    me.easyapps.easynotes 5/22/2025 3:03:53 AM
    com.wemagineai.voila 5/23/2025 8:40:48 AM
    app.organicmaps 5/23/2025 8:22:05 PM
    de.quantumphysique.trale 5/23/2025 8:26:24 PM
    dev.patrickgold.florisboard 5/28/2025 8:49:03 PM
    com.enflick.android.tn2ndLine 6/21/2025 8:56:43 PM
    com.gogii.textplus 6/21/2025 8:59:29 PM
    com.aefyr.sai 6/22/2025 7:39:38 PM
    xyz.klinker.messenger 7/1/2025 11:25:52 AM
    net.kollnig.missioncontrol 9/4/2025 7:46:57 PM
    cz.lsrom.webviewtest 9/5/2025 9:07:46 PM
    network.loki.messenger 9/16/2025 8:22:42 PM
    ak.alizandro.smartaudiobookplayer 9/24/2025 4:06:43 PM
    de.ph1b.audiobook 9/24/2025 4:09:28 PM
    org.cryptomator 10/6/2025 8:01:48 PM
    org.woheller69.audiometry 10/28/2025 10:37:16 PM
    rikka.appops 10/31/2025 10:41:27 PM
    ryey.easer 11/1/2025 7:52:18 PM
    com.fadcam 11/10/2025 8:30:05 AM
    net.osmand.plus 11/13/2025 5:51:15 PM
    com.microsoft.copilot 11/14/2025 6:08:13 AM
    com.elishaazaria.sayboard 11/17/2025 8:02:32 PM
    com.menny.android.anysoftkeyboard 11/17/2025 10:09:43 PM
    dev.soupslurpr.transcribro 11/18/2025 12:21:03 AM
    com.rk.xededitor 11/24/2025 6:57:14 PM
    net.gsantner.markor 11/24/2025 7:02:50 PM
    com.whatsapp 12/1/2025 7:34:06 AM
    com.sonova.phonak.dsapp 12/8/2025 9:07:58 AM
    at.cmg.android.phonews 1/16/2026 5:19:28 AM
    com.machiav3lli.backup 1/18/2026 1:27:53 AM
    me.zhanghai.android.files 1/18/2026 3:17:57 AM
    com.kunzisoft.keepass.libre 1/20/2026 1:33:32 AM
    com.mixplorer.beta 2/4/2026 3:03:57 PM
    com.riteshsahu.SMSBackupRestore 2/4/2026 9:19:41 PM
    opencontacts.open.com.opencontacts.debug 2/5/2026 3:24:40 PM
    sushi.hardcore.droidfs 2/6/2026 9:41:38 AM
    md.obsidian 2/6/2026 12:32:02 PM
    net.typeblog.shelter 2/6/2026 2:18:37 PM
    net.kollnig.missioncontrol.fdroid 2/6/2026 2:20:59 PM
    com.github.libretube 2/6/2026 2:21:24 PM
    org.sufficientlysecure.ical 2/6/2026 2:35:55 PM
    dk.tacit.android.foldersync.lite 2/6/2026 3:21:43 PM
    com.simpol.permissionssummary 2/12/2026 1:58:36 PM
    com.google.android.apps.wallpaper 2/16/2026 2:14:08 PM
    qrcodegenerator.qrcreator.qrmaker.createqrcode 2/24/2026 6:42:03 AM
    moe.zhs.caffeine 3/8/2026 10:14:35 AM
    com.sblabs.vinechart 4/1/2026 11:21:14 PM
    net.programmierecke.radiodroid2 4/13/2026 2:55:52 AM
    org.videolan.vlc 4/13/2026 2:59:49 AM
    io.github.muntashirakon.AppManager 4/21/2026 7:09:46 PM
    com.heyflutter.hello_world 4/26/2026 9:04:24 PM
    com.folderv.file 4/26/2026 10:26:58 PM
    org.woheller69.whisper 4/27/2026 3:20:09 AM
    org.fossify.phone 4/30/2026 8:11:01 PM
    org.fossify.messages 4/30/2026 8:18:35 PM
    org.fossify.gallery 4/30/2026 8:19:24 PM
    org.fossify.filemanager 4/30/2026 8:19:53 PM
    org.fossify.calendar 4/30/2026 8:27:06 PM
    org.fossify.contacts 4/30/2026 8:30:33 PM
    com.cxinventor.file.explorer 5/7/2026 1:45:34 AM
    org.lsposed.lspatch 5/7/2026 3:30:35 AM
    app.fluffy 5/7/2026 3:56:04 AM
    za.kilowatch.ultimatefilemanager 5/7/2026 4:58:14 AM
    gr.nikolasspyr.integritycheck 5/9/2026 12:32:43 AM
    micro.repl.ma7moud3ly 5/17/2026 7:33:23 PM
    org.connectbot 5/18/2026 1:11:09 AM
    name.lmj001.savetodevice 5/18/2026 10:41:39 PM
    aws.apps.usbDeviceEnumerator 5/19/2026 1:34:33 AM
    com.trianguloy.urlchecker 5/19/2026 1:27:31 PM
    --
    On Usenet are helpful kind-hearted people who know how do to things.
    --- Synchronet 3.22a-Linux NewsLink 1.2
  • From Maria Sophia@mariasophia@comprehension.com to comp.mobile.android,alt.comp.os.windows-10,alt.os.linux on Sun May 31 11:16:48 2026
    From Newsgroup: alt.os.linux

    Maria Sophia wrote:
    name.lmj001.savetodevice 5/18/2026 10:41:39 PM

    BTW, what *that* does is add the ability to save anything to your device.

    I had installed that fantastic app, which I had only found out about
    recently, so that I could save any free split APKs from the Google Play
    Store repository without needing to have any mothership account set up on
    and without even needing to install the app before saving the APK.
    <https://i.postimg.cc/SNZzqCQV/saveondevice.jpg>

    Basically, you can scrape the entire Google repository of free APKs with
    that method, since you don't need to set up an account nor install any app.
    <https://i.postimg.cc/wvsbcNBz/scrcpy05.jpg>

    I use it to add to my archive of apps, so that it contains the split APKs.
    <https://i.postimg.cc/9FJMKYch/scrcpy21.jpg>

    This means I'm _still_ learning from others what Android apps are useful.
    And I'm still learning how to make the PC control Android efficiently so.
    --- Synchronet 3.22a-Linux NewsLink 1.2
  • From Maria Sophia@mariasophia@comprehension.com to comp.mobile.android,alt.comp.os.windows-10,alt.os.linux on Sun May 31 11:47:34 2026
    From Newsgroup: alt.os.linux

    Maria Sophia wrote:
    This means I'm _still_ learning from others what Android apps are useful.

    To see what Google's bard thinks of the app list, I pasted it without
    comment and it output the following, which acts as a preliminary audit.

    I had to split the file in half (for buffer length reasons), but I think
    it's useful if others paste their results into a bard analysis session.

    Here's my result of simply pasting - nothing else - just pasting into
    gemini.google.com

    This text is a system log output showing a chronological list of Android application packages (PackageName) alongside the exact date and time they
    were installed or updated (InstallTime) on a specific device.

    The data spans from November 2022 to January 2024 for the first half.

    Based on the types of apps and the timing of their installations, we can extract several interesting insights about this device and its user:

    1. User Profile: A Privacy-Conscious Power User
    This is not a typical casual smartphone setup. The user is highly
    technical, deeply values privacy, and prefers open-source software:

    Alternative App Stores: They installed org.fdroid.fdroid (F-Droid, an open-source app repository) and com.aurora.adroid (Aurora Store, a privacy-focused Google Play client) right at the beginning.

    Rooted/Modified Device: The presence of com.topjohnwu.magisk indicates the device has been rooted using Magisk, allowing for deep administrative
    control over the Android OS.

    Privacy-First Apps: They rely on privacy-centric alternatives like com.duckduckgo.mobile.android, org.torproject.torbrowser,
    ch.protonmail.android (encrypted email), and com.ghostery.android.ghostery.

    De-Googling Leanings: They use the entire suite of apps from Simple Mobile Tools (Gallery, File Manager, Calculator, Calendar) and Secuso (Privacy Friendly apps). These are commonly used by people trying to minimize their reliance on Google ecosystem tracking.

    2. Distinct Waves of Activity
    The install times show heavy batches of activity, which point to specific events in the phone's lifecycle:

    November 1, 2022: Setup Day
    A massive influx of apps occurred on this afternoon/evening. Within a few hours, the user installed a custom launcher (com.teslacoilsw.launcher -
    Nova Launcher), basic utilities (clock, calculator, file manager, camera),
    and privacy tools. This strongly implies the device was either brand new,
    newly factory-reset, or flashed with a custom ROM on this day.

    December 29, 2022: The "Outdoor/Navigation" Focus
    Between midnight and 10:00 AM, the user suddenly installed an immense batch
    of mapping, GPS, and weather apps:

    com.generalmagic.magicearth (Offline navigation)
    com.kylecorry.trail_sense (Hiking/survival multi-tool)
    de.dennisguse.opentracks (Privacy-friendly activity tracker) com.windyty.android & co.windyapp.android (Detailed wind and weather
    modeling)

    Interpretation: The user was likely preparing for an outdoor trip, a
    sailing excursion, a hiking vacation, or testing the phone's offline
    tracking capabilities.

    December 21, 2023: The Automotive "OBD2" Testing
    A year later, at exactly midnight on December 21, 2023, the user installed
    over a dozen vehicle diagnostic tools within minutes (e.g., com.applications.xas.obdultra, com.clickshopping.obddiagscan, com.autoxuga.obd).

    Interpretation: The user was likely troubleshooting a car issue that night. They downloaded a massive batch of On-Board Diagnostics (OBD2) terminal
    apps simultaneously to find one that correctly paired with their vehicle's Bluetooth/Wi-Fi adapter.

    3. Specialized Technical Toolkits
    The device contains numerous tools meant for debugging, tweaking, and
    auditing hardware:

    Networking/Cellular Auditing: cz.mroczis.netmonster, com.vrem.wifianalyzer,
    and net.simplyadvanced.ltediscovery are used to map nearby cell towers,
    analyze Wi-Fi frequencies, and track signal strength.

    Hardware Inspection: Tools like com.evo.inware and com.kgurgul.cpuinfo give granular details about the phone's processor and hardware components.

    Automation & Tweaks: com.llamalab.automate is used to create complex conditional macro scripts on the device, while com.draco.ladb allows
    running Local ADB (Android Debug Bridge) commands directly from the device without needing a computer.

    Location Spoofing: They have multiple apps like com.lexa.fakegps and fake.gps.location.changer.spoof.location to trick the phone's system into thinking it is somewhere else.

    Summary
    This first half log reveals a highly customized, rooted Android device
    managed by an advanced user who utilizes their phone as a multi-tool for privacy, network engineering, outdoor navigation, and vehicle diagnostics .

    Got the second half of the list! Looking closely at this complete layout,
    your device profile has a very distinct, deliberate flavor.

    You lean heavily into open-source (F-Droid/GitHub-centric), privacy-focused toolkits, and niche utility apps (lots of GPX tracking, system analyzers,
    and text-to-speech tools), mixed in with a handful of mainstream daily
    drivers like WhatsApp, Zoom, and Microsoft Copilot.

    Looking at this specific chunk of your timeline, a few notable patterns and standouts pop out:

    1. The Great F-Droid Transition (April 2026)
    Right around April 30, 2026, you systematically installed the Fossify suite (org.fossify.phone, gallery, calendar, etc.). This means you likely
    migrated over to the modern, open-source continuations of the old Simple
    Mobile Tools suite after they changed hands.

    2. Serious Deep-System & Power User Tools
    You have some incredibly powerful utilities here that ordinary users don't touch:

    io.github.muntashirakon.AppManager: One of the most advanced open-source package managers available for managing app freezing, permissions, and
    tracker blocking.

    org.lsposed.lspatch: Used for modifying APKs and inserting Xposed modules without requiring full root access.

    moe.shizuku.privileged.api & rikka.appops: Indicates you use Shizuku to
    grant elevated permissions via ADB for advanced system control.

    sushi.hardcore.droidfs: A specialized utility for creating encrypted
    virtual disks on Android to store sensitive files.

    3. Privacy & Tracker Detection Focus
    You are clearly highly conscious of physical and digital tracking:

    You have both com.apple.trackerdetect and the open-source de.seemoo.at_tracking_detection.release (AirGuard) installed to scan for unauthorized AirTags or Bluetooth trackers around you.

    com.celzero.bravedns: A powerful local VPN/DNS firewall to monitor and
    block outgoing connections from sneaky apps.

    4. Bizarre / Suspicious Oddities to Check
    A couple of items in this list look a bit sketchy, out of place, or
    potentially dangerous depending on where you got them:

    f.cking.software: Yes, that is an actual package name in your list from
    June 2024. It is usually the package ID associated with certain sketchy
    modded apps or joke repositories.

    com.heyflutter.hello_world: This is a default template package name for a generic Flutter app. If you aren't an app developer building your own basic Flutter project, this might be a wrapper for something else entirely.

    com.yuanfang2345.passport: This package structure is often associated with specific third-party Chinese utilities or device sync apps. If you don't recognize it, it's worth auditing.
    --
    Looking at your apps tells others a lot about how you run your device.
    --- Synchronet 3.22a-Linux NewsLink 1.2
  • From Maria Sophia@mariasophia@comprehension.com to comp.mobile.android,alt.comp.os.windows-10,alt.os.linux on Sun May 31 11:52:34 2026
    From Newsgroup: alt.os.linux

    Maria Sophia wrote:
    f.cking.software: Yes, that is an actual package name in your list from
    June 2024. It is usually the package ID associated with certain sketchy modded apps or joke repositories.


    Good news: Despite the aggressive and suspicious-looking name, it isn't malware.

    f.cking.software is the official, internal application package name for BLE Radar (also known as MetaRadar), an open-source privacy app developed by
    the BLE Research Group.

    The developers chose this highly unconventional package ID, and the app
    itself is actually published and verified on the official F-Droid
    repository.

    What does the app do?
    It fits perfectly into the rest of your privacy toolkit. BLE Radar is an application that scans your immediate physical surroundings for Bluetooth
    Low Energy (BLE) signals. It is primarily used to:

    Track and map local Bluetooth devices.

    Locate lost gadgets or beacons.

    Audit the area around you for unknown, potentially tracking-heavy smart devices.

    Why is the package name so weird?
    In Android development, package names (like com.google.android.youtube) are traditionally structured as a reverse domain name (domain.company.app). The developers of this app own the domain f*cking.software (which points to
    their GitHub organization). Because they use that domain for their project,
    the resulting Android package identity became f.cking.software.

    You can rest easy on this one-it's just a cheeky name for a completely legitimate, open-source Bluetooth defense tool !
    --- Synchronet 3.22a-Linux NewsLink 1.2
  • From Jeff Layman@Jeff@invalid.invalid to comp.mobile.android,alt.comp.os.windows-10,alt.os.linux on Sun May 31 20:29:18 2026
    From Newsgroup: alt.os.linux

    On 31/05/2026 17:58, Maria Sophia wrote:
    Maria Sophia wrote:
    Best includes it does something useful, is free, no ads, no login.

    Here's my file of 617 apps I personally installed on my free 64GB A325G.

    If you know of other useful (free, private, no account, no ads) apps not on this list, please let us all know as that's the original goal.

    Have we tested every free useful app on Android by now?
    Dunno.

    I probably tested 5 to 10 times the number of apps that are on my 64GB storage, but here is the current set of 617 apps that I didn't delete.

    Out of interest, have you tried Canta debloater? It requires Shizuku,
    but, I understand, not adb to use it.
    --
    Jeff
    --- Synchronet 3.22a-Linux NewsLink 1.2
  • From Maria Sophia@mariasophia@comprehension.com to comp.mobile.android,alt.comp.os.windows-10,alt.os.linux on Sun May 31 14:19:22 2026
    From Newsgroup: alt.os.linux

    Jeff Layman wrote:
    I probably tested 5 to 10 times the number of apps that are on my
    64GB storage, but here is the current set of 617 apps that I didn't delete.

    Out of interest, have you tried Canta debloater? It requires Shizuku,
    but, I understand, not adb to use it.

    Hi Jeff,

    Good question.
    <https://kevinboone.me/canta.htm>
    <https://maketecheasier.com/canta-debloat-android-phone-without-adb/>
    <https://www.reddit.com/r/androidroot/comments/1tkf7bi/how_to_remove_bloatware_on_android_with_no_root/>
    etc.

    Because USA-spec Samsung bootloaders aren't unlockable, both Canta and adb utilize the pm uninstall -k --user 0 command. This doesn't delete the app
    from the system partition (which requires root), but it completely
    uninstalls it for your user profile, stopping it from running, eating RAM, consuming battery, or showing up in your app drawer.

    Both Canta & adb can use Shizuku either over USB or Wi-Fi and while adb
    offers zero guidance, Canta pulls from the crowdsourced Universal Android Debloater (UAD) database which automatically filters the apps and
    color-codes them with safety warnings:

    If I were to start again, I might use Canta but since I started with adb
    years ago, I've debloated over 400 system packages using just adb alone.

    Sometimes I use Muntashirakon App Manager, which I know you have, which
    tells me what to debloat, but Canta would do it more gracefully for sure.

    For someone starting fresh, I'd agree with you that they should use Canta.
    --- Synchronet 3.22a-Linux NewsLink 1.2
  • From Maria Sophia@mariasophia@comprehension.com to comp.mobile.android,alt.comp.os.windows-10,alt.os.linux on Sun May 31 18:36:56 2026
    From Newsgroup: alt.os.linux

    Maria Sophia wrote:
    Sometimes I use Muntashirakon App Manager, which I know you have, which
    tells me what to debloat, but Canta would do it more gracefully for sure.

    For someone starting fresh, I'd agree with you that they should use Canta

    So how does one run Canta debloating on the PC (Linux, Windows or macOS)?
    I don't know. I never did it. I just use adb & Muntashirakon myself.

    So I looked it up.
    Using my own links.

    Typo on a prior link (it was missing the last character of "html"):
    <https://kevinboone.me/canta.html>
    <https://maketecheasier.com/canta-debloat-android-phone-without-adb/>
    <https://www.reddit.com/r/androidroot/comments/1tkf7bi/how_to_remove_bloatware_on_android_with_no_root/>

    Canta uses a list of bloatware from the Universal Debloater Alliance. <https://github.com/Universal-Debloater-Alliance/universal-android-debloater-next-generation/>
    which is a file that contains
    a. the package name (e.g., com.samsung.android.bixby.agent)
    b. a description of what the app does
    c. safety level (Recommended / Advanced / Expert / Unsafe)
    d. whether it's safe to disable or uninstall
    e. descriptive tags (e.g., "bloatware", "analytics", "carrier", etc.)

    Canta (cantar, to sing) is the Rust-based compiler that takes raw package definitions & turns them into the final uad_lists.json that UAD-NG uses.
    a. You never install anything called "Canta"
    b. You never run it either.
    c. It's just part of the build system.

    On Android:
    a. Enable USB debugging in the Developer options
    b. Connect the phone (via Wi-Fi or USB) to the PC adb
    c. Run the PC Canta command listed below to open the GUI

    It's a good idea to dump all the currently installed packages:
    adb shell pm list packages > installed_packages_backup.txt
    Because you can re-install them if/when you make a mistake:
    adb shell cmd package install-existing com.samsung.android.bixby.agent

    For Linux (instructions are similar for macOS)
    Download & extract the uad-ng-linux.tar.gz tarball.
    <https://github.com/Universal-Debloater-Alliance/universal-android-debloater-next-generation/releases/download/v1.2.0/uad-ng-linux.tar.gz>
    Or download the uad-ng-linux binary binary:
    <https://github.com/Universal-Debloater-Alliance/universal-android-debloater-next-generation/releases/download/v1.2.0/uad-ng-linux>
    Install adb on Linux:
    $ sudo apt install android-tools-adb (Debian/Ubuntu/Mint)
    $ sudo dnf install android-tools (Fedora/Centos/Redhat)
    $ sudo pacman -S android-tools (Arch/Manjaro/EndeavorOS)
    Run the Canta debloater:
    $ chmod +x uad-ng-linux
    $ ./uad-ng-linux
    a. Pick a category (Recommended is safest)
    b. Click a package (example: Facebook App Manager)
    c. Click Uninstall

    For Windows:
    Download the uad-ng-windows.exe for Windows.
    <https://github.com/Universal-Debloater-Alliance/universal-android-debloater-next-generation/releases/download/v1.2.0/uad-ng-windows.exe>
    uad-ng-windows.exe
    a. Wait for UAD-NG to detect your phone
    b. Choose the "Recommended" category
    c. Pick a package (e.g., Facebook App Manager)
    d. Click Uninstall

    After a while, you'll want to export your debloated list.
    a. Open UAD-NG
    b. Go to File -> Export selection
    c. Save the file (usually a .json or .txt list)
    This file contains:
    A. Every package you uninstalled
    B. Their package names
    C. Their categories

    You can restore using Canta
    a. Open UAD-NG
    b. File -> Import selection
    c. Click Restore (sometimes called "Install")

    Note that almost always, you can't harm the system, if you
    go slowly, because almost always you can re-install the pkg.

    Out of ~400 system packages I manually removed, only 1 bit me back.
    --
    My conversations are deep because they cover more detail than most do.
    --- Synchronet 3.22a-Linux NewsLink 1.2
  • From Maria Sophia@mariasophia@comprehension.com to comp.mobile.android,alt.comp.os.windows-10,alt.os.linux on Sun May 31 20:25:26 2026
    From Newsgroup: alt.os.linux

    Maria Sophia wrote:
    Download the uad-ng-windows.exe for Windows.
    <https://github.com/Universal-Debloater-Alliance/universal-android-debloater-next-generation/releases/download/v1.2.0/uad-ng-windows.exe>
    uad-ng-windows.exe
    a. Wait for UAD-NG to detect your phone
    b. Choose the "Recommended" category
    c. Pick a package (e.g., Facebook App Manager)
    d. Click Uninstall

    Having always debloated the hard way, I downloaded the Windows binary. <https://github.com/Universal-Debloater-Alliance/universal-android-debloater-next-generation/releases/download/v1.2.0/uad-ng-windows.exe>
    Name: uad-ng-windows.exe
    Size: 19742208 bytes (18 MiB)
    SHA256: F58666D5F54FAD19DDB317978019437A6F7B2E67FB869157DF9BD40965296600

    Since the phone is on the LAN, I connected the PC to the phone over adb.
    I copied uad-ng-windows.exe into the adb folder & doubleclicked it.

    Lo and behold, there wwere *plenty* of packages I missed uninstalling!
    I could list them by
    all lists
    aosp
    carrier
    google
    misc
    oem
    pending
    unlisted

    So, I clicked "carrier" and these showed up to uninstall on T-Mo:
    com.sprint.ce.updater
    com.sprint.ms.cdm
    com.sprint.ms.smf.services
    com.sprint.w.installer
    com.tmobile.pr.adapt

    Setting it to "google", there were only two to uninstall
    com.google.android.apps.maps (which I decided to keep)
    com.google.android.apps.restore
    Not knowing about that last app, I clicked on it and it said:
    The backup restore wizard used for pulling Android system
    backups from your Google account. Runs on boot.
    You only need this if you factory restore, in which case
    it's automatically re-enabled for you.

    Since I've never had a Google Account on the phone, I blew
    it away, and then I selected the "aosp" list which showed
    com.android.egg
    com.android.providers.partnerbookmarks
    com.android.theme.font.notoserifsource
    com.android.traceur
    com.google.android.nearby.halfsheet
    com.google.android.onedevicepersonalization.services
    com.google.mainline.adservices
    After clicking on each to see what they do, I wiped them.

    For "oem", the listing was about the same number of packages.
    com.amazon.appmanager
    com.diotek.sec.lookup.dictionary
    com.mediatek.entitlement.fcm (my CPU is mediatek)
    com.mediatek.gbaseervice
    com.mediatek.mdmlsample
    com.microsoft.appmanager
    com.monotype.android.font.foundation
    com.tmobile.echolocate

    Interesting was the help for the Microsoft package:
    Link to Windows
    (https://play.google.com/store/apps/details?id=com.microsoft.appmanager)
    Microsoft app for synchronising your phone with a Windows PC .

    The only one that failed to uninstall was the echolocate pkg.
    [Recommended] pm uninstall --user 0 com.tmobile.echolocate
    -> Failed to uninstall a package: com.tmobile.echolocate

    The "oem" section was huge, so I exported the selection.
    android.autoinstalls.config.samsung
    com.hiya.star
    com.knox.vpn.proxyhandler
    com.mediatek.apmonitor
    com.monotype.android.font.samsungone
    com.samsung.aasaservice
    com.samsung.adaptivebrightnessgo
    com.samsung.android.allshare.service.mediashare
    com.samsung.android.app.telephonyui.esimclient
    com.samsung.android.app.updatecenter
    com.samsung.android.app.watchmanagerstub
    com.samsung.android.ardrawing
    com.samsung.android.bbc.bbcagent
    com.samsung.android.da.daagent
    com.samsung.android.dck.timesync
    com.samsung.android.dsms
    com.samsung.android.easysetup
    com.samsung.android.fast
    com.samsung.android.fmm
    com.samsung.android.game.gos
    com.samsung.android.hdmapp
    com.samsung.android.inputshare
    com.samsung.android.keycustomizationinfobackupservice
    com.samsung.android.knox.analytics.uploader
    com.samsung.android.knox.attestation
    com.samsung.android.knox.containercore
    com.samsung.android.knox.kpecore
    com.samsung.android.knox.pushmanager
    com.samsung.android.mcfds
    com.samsung.android.mdecservice
    com.samsung.android.mdm
    com.samsung.android.networkdiagnostic
    com.samsung.android.privateshare
    com.samsung.android.samsungpositioning
    com.samsung.android.sdk.handwriting
    com.samsung.android.sdm.config
    com.samsung.android.server.wifi.mobilewips
    com.samsung.android.service.stplatform
    com.samsung.android.shortcutbackupservice
    com.samsung.android.smartcallprovider
    com.samsung.android.smartsuggestions
    com.samsung.android.smartswitchassistant
    com.samsung.android.stickercenter
    com.samsung.android.svcagent
    com.samsung.android.vtcamerasettings
    com.samsung.faceservice
    com.samsung.InputEventApp
    com.samsung.ipservice
    com.samsung.knox.securefolder
    com.samsung.oda.service
    com.samsung.safetyinformation
    com.samsung.sec.android.teegris.tui_service
    com.sec.android.app.bluetoothagent
    com.sec.android.app.chromecustomizations
    com.sec.android.app.DataCreate
    com.sec.android.app.factorykeystring
    com.sec.android.app.hwmoduletest
    com.sec.android.app.magnifier
    com.sec.android.app.parser
    com.sec.android.app.quicktool
    com.sec.android.app.servicemodeapp
    com.sec.android.app.setupwizard
    com.sec.android.app.setupwizardlegalprovider
    com.sec.android.app.soundalive
    com.sec.android.app.ve.vebgm
    com.sec.android.app.wlantest
    com.sec.android.autodoodle.service
    com.sec.android.CcInfo
    com.sec.android.daemonapp
    com.sec.android.easyMover.Agent
    com.sec.android.easyonehand
    com.sec.android.iaft
    com.sec.android.RilServiceModeApp
    com.sec.android.smartfpsadjuster
    com.sec.android.widgetapp.easymodecontactswidget
    com.sec.app.RilErrorNotifier
    com.sec.bcservice
    com.sec.enterprise.knox.cloudmdm.smdms
    com.sec.enterprise.mdm.services.simpin
    com.sec.epdgtestapp
    com.sec.facatfunction
    com.sec.factory.camera
    com.sec.factory.cameralyzer
    com.sec.hearingadjust
    com.sec.hiddenmenu
    com.sec.imslogger
    com.sec.location.nfwlocationprivacy
    com.sec.location.nsflp2
    com.sec.providers.assisteddialing
    com.sec.vsim.ericssonnsds.webapp
    com.skms.android.agent
    com.snap.camerakit.plugin.v1
    com.test.LTEfunctionality
    com.tmobile.echolocate

    What's interesting, is I already had debloated, or so I thought.
    Even as I removed over 400 packages, there are a few hundred more.

    My assessment, so far, is that Canta is pretty good.
    It makes debloating even easier than I had thought.

    Funny thing though, I never needed to touch Shizuku.
    Looking up why, Shizuku is only needed when you're debloating from the
    phone alone (without the PC) and you need adb-level permission sans a PC.

    I guess I'll try running Canta (with Shizuku) on the phone next.
    --
    On Usenet, shared experience saves someone else a long night of guessing.
    .
    --- Synchronet 3.22a-Linux NewsLink 1.2
  • From Maria Sophia@mariasophia@comprehension.com to comp.mobile.android,alt.comp.os.windows-10,alt.os.linux on Sun May 31 21:28:47 2026
    From Newsgroup: alt.os.linux

    Maria Sophia wrote:
    I guess I'll try running Canta (with Shizuku) on the phone next.

    Since I operate the phone 100% from the PC, on the PC I downloaded the
    Canta APK which comes from F-Droid so I could debloat without the PC.
    <https://f-droid.org/en/packages/io.github.samolego.canta/>
    <https://f-droid.org/repo/io.github.samolego.canta_225.apk>
    Name: io.github.samolego.canta_225.apk
    Size: 4698310 bytes (4588 KiB)
    SHA256: 5A646D366905C0BE2033AA270B008B3EF79FDA99FBC95988445B0F430283A1ED

    I already had Shizuku, but for others, you can pick it up over here.
    <https://github.com/rikkaapps/shizuku>
    <https://github.com/RikkaApps/Shizuku/releases/tag/v13.6.0>
    <https://github.com/RikkaApps/Shizuku/releases/download/v13.6.0/shizuku-v13.6.0.r1086.2650830c-release.apk>
    Name: shizuku-v13.6.0.r1086.2650830c-release.apk
    Size: 2571773 bytes (2511 KiB)
    SHA256: 6E273AB0E991C4E79BC8B1BBB9B9DD739CCAC1A8712A541A214078886B7B790F

    Or, you can pick it up on the Google Play store if you like.
    <https://play.google.com/store/apps/details?hl=en_US&id=moe.shizuku.privileged.api>
    Here is the Shizuku User Guide (which I've never read myself).
    <https://shizuku.rikka.app/guide/setup.html>

    Since you control the phone completely from the PC, run this
    adb shell pm trim-caches 999G
    adb install "C:\canta\io.github.samolego.canta_225.apk"
    adb install "C:\canta\shizuku-v13.6.0.r1086.2650830c-release.apk"

    Now you can run Canta on the phone from the mirrored image on the PC:
    scrcpy-noconsole.vbs
    Then operate Canta & Shizuku from the mirror image on your PC monitor.

    The funny thing, surprisingly, is a *lot* more stuff was highlighted
    in the Canta running on Android than in the Canta running on Windows.

    I arbitrarily clicked on BBCAgent <com.samsung.android.bbc.bcagent>
    and up popped "Shizuku Required" saying
    "Canta uses Shizuku to uninstall apps without requiring root access.
    Shizuku provides a secure way to access system=-level SDKs."
    a. Start Shizuku service
    b. Grant permission to Canta in Shizuku

    When I pressed "Start Shizuku service" it gave me this command.
    Which I ran in Windows, which started the Android Shizuku service.
    adb shell sh /storage/emulated/0/Android/data/moe.shizuku.privileged.api/start.sh

    Then I pressed "Grant permission to Canta in Shizuku" and it
    removed the selected BBCAgent package from the Android device.

    Unfortunately each time you delete an app, it asks you to
    Donate, which is kind of a pain, but other than that, the
    Android version of Canta seems to be just as easy to use
    as the PC version of Canta, the only difference, apparently,
    being that the Android version of Canta has a different GUI.

    I'm pretty surprised that the Android Canta found more stuff
    to debloat than did the Windows Canta, but other than that,
    they're both easy to use to debloat your Android safely.

    Both seem to work well, so I thank Jeff for his great ideas.
    a. Canta on Android + Shizuku on Android
    b. Canta on the PC + adb on the PC
    --
    On Usenet, some of us share what we have learned so others do not struggle.
    --- Synchronet 3.22a-Linux NewsLink 1.2
  • From Carlos E.R.@robin_listas@es.invalid to comp.mobile.android,alt.comp.os.windows-10,alt.os.linux on Mon Jun 1 12:05:58 2026
    From Newsgroup: alt.os.linux

    On 2026-06-01 02:36, Maria Sophia wrote:
    Maria Sophia wrote:
    Sometimes I use Muntashirakon App Manager, which I know you have, which
    tells me what to debloat, but Canta would do it more gracefully for sure.

    For someone starting fresh, I'd agree with you that they should use Canta

    So how does one run Canta debloating on the PC (Linux, Windows or macOS)?
    I just realized that my new tablet doesn't have, on first boot, any user facing apps. Well, there is google play, obviously, the camera, I don't
    know what else. Nothing like tik-tok, facebook. I had to select what
    browser I wanted. I believe everything can be uninstalled. Everything
    got installed during the first boot.
    --
    Cheers, Carlos.
    ES🇪🇸, EU🇪🇺;
    --- Synchronet 3.22a-Linux NewsLink 1.2
  • From Maria Sophia@mariasophia@comprehension.com to comp.mobile.android,alt.comp.os.windows-10,alt.os.linux on Mon Jun 1 10:14:20 2026
    From Newsgroup: alt.os.linux

    Carlos E.R. wrote:
    So how does one run Canta debloating on the PC (Linux, Windows or macOS)?

    I just realized that my new tablet doesn't have, on first boot, any user facing apps. Well, there is google play, obviously, the camera, I don't
    know what else. Nothing like tik-tok, facebook. I had to select what
    browser I wanted. I believe everything can be uninstalled. Everything
    got installed during the first boot.

    Hi Carlos,

    That may be true, but then again, never once have I seen the Android GUI
    tell the truth about anything, so you'll have to test your assessment.

    An example is many people "think" there are only a dozen (or so) packages
    which can read their contacts, because that's what the GUI tells them.

    And yet, when we look using adb, we find that the GUI lied to us about it.
    For sure, the number of packages on our devices is NOT what the GUI shows.
    adb shell pm list packages

    The only way to tell, for sure, is to run adb but Muntashirakon will help.
    <https://muntashirakon.github.io/AppManager/en/> English
    <https://muntashir.dev/AppManager/es/> Spanish

    The Android GUI lies.
    But you won't know the Android GUI lies until you test it as above.
    --- Synchronet 3.22a-Linux NewsLink 1.2
  • From Skeptic@invalid@invalid.invalid to comp.mobile.android,alt.comp.os.windows-10,alt.os.linux on Mon Jun 1 20:45:36 2026
    From Newsgroup: alt.os.linux

    On 01/06/2026 04:28, Maria Sophia wrote:
    Since I operate the phone 100% from the PC, on the PC I downloaded the
    Canta APK which comes from F-Droid so I could debloat without the PC.

    Deboating a phone is new to me, and perhaps alien to many here, so tell
    me: does it slow down the service of sending your voice over the phone?
    I was just wondering!

    Is messing around with Android phones one of your hobbies? Android OS is
    owned by Google but used mostly by people who care about privacy! The
    meaning of privacy must have changed recently.







    --- Synchronet 3.22a-Linux NewsLink 1.2
  • From Ch1ffr3punk@ch1ffr3punk@gmail.com to comp.mobile.android,alt.comp.os.windows-10,alt.os.linux on Mon Jun 1 20:12:32 2026
    From Newsgroup: alt.os.linux

    Skeptic wrote:

    Is messing around with Android phones one of your hobbies? Android OS is owned by Google but used mostly by people who care about privacy! The meaning of privacy must have changed recently.

    Android, when used with PlugOS [1], is a super awesome privacy device,
    when additionally used with AEC [2] = Air Gapped Encrypted Communications
    and a little air gapped GPD MicroPC [3] *with Windows 11*, which beats any online Linux box with outdated GnuPG or OpenPGP, when it comes to first
    class secure and anonymous email communications, via the Nym Mixnet [4].

    [1] https://plugos.net/plugmate
    [2] coming soon
    [3] https://www.gpd.hk/gpdmicropc2345345345
    [4] https://nym.com/mixnet

    Best regards
    Ch1ffr3punk
    --
    https://oc2mx.net
    --- Synchronet 3.22a-Linux NewsLink 1.2
  • From Jeff Layman@Jeff@invalid.invalid to comp.mobile.android,alt.comp.os.windows-10,alt.os.linux on Mon Jun 1 21:17:20 2026
    From Newsgroup: alt.os.linux

    On 01/06/2026 04:28, Maria Sophia wrote:
    Maria Sophia wrote:
    I guess I'll try running Canta (with Shizuku) on the phone next.

    Since I operate the phone 100% from the PC, on the PC I downloaded the
    Canta APK which comes from F-Droid so I could debloat without the PC.
    <https://f-droid.org/en/packages/io.github.samolego.canta/>
    <https://f-droid.org/repo/io.github.samolego.canta_225.apk>
    Name: io.github.samolego.canta_225.apk
    Size: 4698310 bytes (4588 KiB)
    SHA256: 5A646D366905C0BE2033AA270B008B3EF79FDA99FBC95988445B0F430283A1ED

    I already had Shizuku, but for others, you can pick it up over here.
    <https://github.com/rikkaapps/shizuku>
    <https://github.com/RikkaApps/Shizuku/releases/tag/v13.6.0>
    <https://github.com/RikkaApps/Shizuku/releases/download/v13.6.0/shizuku-v13.6.0.r1086.2650830c-release.apk>
    Name: shizuku-v13.6.0.r1086.2650830c-release.apk
    Size: 2571773 bytes (2511 KiB)
    SHA256: 6E273AB0E991C4E79BC8B1BBB9B9DD739CCAC1A8712A541A214078886B7B790F

    Or, you can pick it up on the Google Play store if you like.
    <https://play.google.com/store/apps/details?hl=en_US&id=moe.shizuku.privileged.api>
    Here is the Shizuku User Guide (which I've never read myself).
    <https://shizuku.rikka.app/guide/setup.html>

    Since you control the phone completely from the PC, run this
    adb shell pm trim-caches 999G
    adb install "C:\canta\io.github.samolego.canta_225.apk"
    adb install "C:\canta\shizuku-v13.6.0.r1086.2650830c-release.apk"

    Now you can run Canta on the phone from the mirrored image on the PC:
    C:\> scrcpy-noconsole.vbs
    Then operate Canta & Shizuku from the mirror image on your PC monitor.

    The funny thing, surprisingly, is a *lot* more stuff was highlighted
    in the Canta running on Android than in the Canta running on Windows.

    I arbitrarily clicked on BBCAgent <com.samsung.android.bbc.bcagent>
    and up popped "Shizuku Required" saying
    "Canta uses Shizuku to uninstall apps without requiring root access.
    Shizuku provides a secure way to access system=-level SDKs."
    a. Start Shizuku service
    b. Grant permission to Canta in Shizuku

    When I pressed "Start Shizuku service" it gave me this command.
    Which I ran in Windows, which started the Android Shizuku service.
    C:\> adb shell sh /storage/emulated/0/Android/data/moe.shizuku.privileged.api/start.sh

    Then I pressed "Grant permission to Canta in Shizuku" and it
    removed the selected BBCAgent package from the Android device.

    Unfortunately each time you delete an app, it asks you to
    Donate, which is kind of a pain, but other than that, the
    Android version of Canta seems to be just as easy to use
    as the PC version of Canta, the only difference, apparently,
    being that the Android version of Canta has a different GUI.

    I'm pretty surprised that the Android Canta found more stuff
    to debloat than did the Windows Canta, but other than that,
    they're both easy to use to debloat your Android safely.

    Both seem to work well, so I thank Jeff for his great ideas.
    a. Canta on Android + Shizuku on Android
    b. Canta on the PC + adb on the PC

    Well you did all the work! I meant to ask about Canta a month or two ago
    when I saw it in the F-Droid "Latest" list. It looked interesting and I thought it had said that adb wasn't required. Unfortunately when I
    checked after seeing your OP in this thread, it had already disappeared
    from the latest list, and the current entry for Canta doesn't mention
    adb, only Shizuku.
    --
    Jeff
    --- Synchronet 3.22a-Linux NewsLink 1.2
  • From Jeff Layman@Jeff@invalid.invalid to comp.mobile.android,alt.comp.os.windows-10,alt.os.linux on Mon Jun 1 22:39:25 2026
    From Newsgroup: alt.os.linux

    On 01/06/2026 21:12, Ch1ffr3punk wrote:
    Skeptic wrote:

    Is messing around with Android phones one of your hobbies? Android OS is
    owned by Google but used mostly by people who care about privacy! The
    meaning of privacy must have changed recently.

    I would guess that most people who use a cellphone have no interest in privacy.

    Android, when used with PlugOS [1], is a super awesome privacy device,
    when additionally used with AEC [2] = Air Gapped Encrypted Communications
    and a little air gapped GPD MicroPC [3] *with Windows 11*, which beats any online Linux box with outdated GnuPG or OpenPGP, when it comes to first
    class secure and anonymous email communications, via the Nym Mixnet [4].

    [1] https://plugos.net/plugmate

    Recent reviews:

    <https://uk.pcmag.com/security/165179/i-was-sick-of-android-apps-spying-on-me-so-i-tried-grapheneos-and-plugos>

    <https://www.clubic.com/actualite-598732-plugos-un-pc-android-dans-une-cle-usb-c-securisee-ne-tombez-pas-dans-le-piege.html>
    (In French, but translatable with Firefox, or using DeepL or Google
    Translate)
    --
    Jeff
    --- Synchronet 3.22a-Linux NewsLink 1.2
  • From Carlos E.R.@robin_listas@es.invalid to comp.mobile.android,alt.comp.os.windows-10,alt.os.linux on Mon Jun 1 23:45:26 2026
    From Newsgroup: alt.os.linux

    On 2026-06-01 23:39, Jeff Layman wrote:
    On 01/06/2026 21:12, Ch1ffr3punk wrote:
    Skeptic wrote:

    Is messing around with Android phones one of your hobbies? Android OS is >>> owned by Google but used mostly by people who care about privacy! The
    meaning of privacy must have changed recently.

    I would guess that most people who use a cellphone have no interest in privacy.

    I would certainly use a phone with neither Android nor Iphone.
    --
    Cheers, Carlos.
    ES🇪🇸, EU🇪🇺;
    --- Synchronet 3.22a-Linux NewsLink 1.2
  • From Maria Sophia@mariasophia@comprehension.com to comp.mobile.android,alt.comp.os.windows-10,alt.os.linux on Mon Jun 1 15:55:35 2026
    From Newsgroup: alt.os.linux

    Jeff Layman wrote:
    Is messing around with Android phones one of your hobbies? Android OS is >>> owned by Google but used mostly by people who care about privacy! The
    meaning of privacy must have changed recently.

    I would guess that most people who use a cellphone have no interest in privacy.


    Hi Jeff,

    I would disagree but I would half agree that 99 out of 100 people don't
    know the first thing about privacy, so, half of those 99 buy Apple devices because Apple told them it's more private, even as iOS is not private.

    My point is they care, but they don't know how to obtain any privacy.

    By far, the most important act anyone could do on any computing device, is
    NOT put a mothership account on that device, which is easy for Android.

    Android works better without the Google account than it does with it.

    Android, when used with PlugOS [1], is a super awesome privacy device,
    when additionally used with AEC [2] = Air Gapped Encrypted Communications
    and a little air gapped GPD MicroPC [3] *with Windows 11*, which beats any >> online Linux box with outdated GnuPG or OpenPGP, when it comes to first
    class secure and anonymous email communications, via the Nym Mixnet [4].

    [1] https://plugos.net/plugmate

    Recent reviews:

    <https://uk.pcmag.com/security/165179/i-was-sick-of-android-apps-spying-on-me-so-i-tried-grapheneos-and-plugos>

    <https://www.clubic.com/actualite-598732-plugos-un-pc-android-dans-une-cle-usb-c-securisee-ne-tombez-pas-dans-le-piege.html>
    (In French, but translatable with Firefox, or using DeepL or Google Translate)

    Since most USA-spec Samsung devices can't be rooted, GrapheneOS isn't available, but I didn't know about PlugOS until it was mentioned above.
    a. You plug the PlugOS USB-C stick into your phone.
    b. The phone treats it like an external display + input device.
    c. PlugOS runs on the stick, not on the phone.
    d. The phone is basically just a screen + power source .
    So it doesn't matter that USA Samsung's can't unlock the bootloader.

    PlusOS won't work for my Samsung because the phone must support DisplayPort
    Alt Mode, which mine doesn't support. But PlugOS even works on iOS so it's
    a nice idea for those whose USB port supports it.
    --- Synchronet 3.22a-Linux NewsLink 1.2
  • From Maria Sophia@mariasophia@comprehension.com to comp.mobile.android,alt.comp.os.windows-10,alt.os.linux on Mon Jun 1 15:56:51 2026
    From Newsgroup: alt.os.linux

    Skeptic wrote:
    On 01/06/2026 04:28, Maria Sophia wrote:
    Since I operate the phone 100% from the PC, on the PC I downloaded the
    Canta APK which comes from F-Droid so I could debloat without the PC.

    Deboating a phone is new to me, and perhaps alien to many her

    I think everyone has removed the crapware that comes with a new device.
    --- Synchronet 3.22a-Linux NewsLink 1.2
  • From Maria Sophia@mariasophia@comprehension.com to comp.mobile.android,alt.comp.os.windows-10,alt.os.linux on Mon Jun 1 16:07:32 2026
    From Newsgroup: alt.os.linux

    Jeff Layman wrote:
    Both seem to work well, so I thank Jeff for his great ideas.
    a. Canta on Android + Shizuku on Android
    b. Canta on the PC + adb on the PC

    Well you did all the work! I meant to ask about Canta a month or two ago when I saw it in the F-Droid "Latest" list. It looked interesting and I thought it had said that adb wasn't required. Unfortunately when I
    checked after seeing your OP in this thread, it had already disappeared
    from the latest list, and the current entry for Canta doesn't mention
    adb, only Shizuku.

    Well, I had heard about Canta for years, but I was so heavily invested in
    adb that it didn't occur to me to test it out for the team until now.

    The good news is both the desktop and Android versions worked just fine.

    And both the PC & phone Canta were easy enough to use, but I was surprised
    that different apps showed up given they both come from a similar source.

    If I had to recommend one, I'd recommend the Android version for that
    reason as it seemed to find more stuff to debloat than the PC version did.

    But there's one caveat...

    Even though Canta "supposedly" doesn't need adb on the PC (since it uses Shizuku on the phone), I had to use adb to invoke Shizuku on the phone.
    adb shell sh /storage/emulated/0/Android/data/moe.shizuku.privileged.api/start.sh

    To me, that's no big deal, but for someone who is trying to avoid running
    adb on the PC, that would be a problem, but I assume Shizuku could have
    been invoked on the phone without needing to invoke it using ADB on the PC.

    While I'm probably more experienced than the average person in terms of
    running specialized software, I'd say Canta/Shizuku were both well written.

    You shouldn't have problems running them, and to help out, I actually
    installed the Shizuku version I listed so that I was testing what I wrote.
    --
    On Usenet, we're all old friends on the same kind & helpful team.
    --- Synchronet 3.22a-Linux NewsLink 1.2
  • From Maria Sophia@mariasophia@comprehension.com to comp.mobile.android,alt.comp.os.windows-10,alt.os.linux on Mon Jun 1 16:26:00 2026
    From Newsgroup: alt.os.linux

    Just for the record, I keep an archive of every single app I've ever
    installed so it can be done, but since APKs come from different places, it
    has to be done with an overall tactical plan in mind.

    The strategy, of course, is save every APK before it's installed.
    The tactics can vary.

    My tactics are to put all the APKs on a separate USB drive, for the obvious reasons of portability and because they serve no purpose on a computer.

    My download tactics are to use a PC web browser (any browser I want) to download the APK for all APKs which are not on the Google Play Store repo.

    If they're on the Google Play Store repo, then my tactic is to use any replacement FOSS Google Play Store app to *download* the split APK.

    Notice you'll almost always, if not always get a split APK from the Google
    Play Store repo, while you'll almost always, if not always NOT get a split
    APK from all the other repositories, so you have to learn how to handle
    split APKs (because Android doesn't come with a native split-apk
    installer).

    The split APKs are saved as "apks" while the regular APKs are saved as
    "apk" so you know which are which (sometimes split APKs are saved as a zip file, which is what they are anyway).

    The strategy is to first save the APK(s) and then install them.
    The tactic to install them is as simple as copying them temporarily to the Android phone and tapping on them in Android to install them, or, since
    they serve no purpose on the Android phone, just installing them from the
    PC on the Android phone, over Wi-Fi (or USB) using adb on the desktop.

    I jsut did that, for example, when I downloaded Canta & Shizuku.

    1. Download the Canta/Shizuku APK onto the desktop using a PC browser
    <https://f-droid.org/en/packages/io.github.samolego.canta/>
    <https://f-droid.org/repo/io.github.samolego.canta_225.apk>
    Name: io.github.samolego.canta_225.apk
    Size: 4698310 bytes (4588 KiB)
    SHA256: 5A646D366905C0BE2033AA270B008B3EF79FDA99FBC95988445B0F430283A1ED

    <https://github.com/rikkaapps/shizuku>
    <https://github.com/RikkaApps/Shizuku/releases/tag/v13.6.0>
    <https://github.com/RikkaApps/Shizuku/releases/download/v13.6.0/shizuku-v13.6.0.r1086.2650830c-release.apk>
    Name: shizuku-v13.6.0.r1086.2650830c-release.apk
    Size: 2571773 bytes (2511 KiB)
    SHA256: 6E273AB0E991C4E79BC8B1BBB9B9DD739CCAC1A8712A541A214078886B7B790F

    2. Install the Canta/Shizuku APK onto the phone using the PC adb
    adb install "C:\temp\io.github.samolego.canta_225.apk"
    adb install "C:\temp\shizuku-v13.6.0.r1086.2650830c-release.apk"

    It's that easy to implement the strategy of saving every APK before you
    install it on the phone. The tactics vary depending on how much you know.
    --
    Sharing what I learn so others do not have to dig as hard.
    --- Synchronet 3.22a-Linux NewsLink 1.2
  • From Ch1ffr3punk@ch1ffr3punk@gmail.com to comp.mobile.android,alt.comp.os.windows-10,alt.os.linux on Tue Jun 2 09:33:24 2026
    From Newsgroup: alt.os.linux

    Jeff Layman wrote:

    Recent reviews:

    <https://uk.pcmag.com/security/165179/i-was-sick-of-android-apps-spying-on-me-so-i-tried-grapheneos-and-plugos>

    Well, the author does not mention that it works also on Linux,
    Windows and macOS... Does Graphene supports this? And my new
    smartphone had cost me only 135 € compared to a Pixels...

    Regards
    Ch1ffr3punk
    --
    https://oc2mx.net
    --- Synchronet 3.22a-Linux NewsLink 1.2
  • From Jeff Layman@Jeff@invalid.invalid to comp.mobile.android,alt.comp.os.windows-10,alt.os.linux on Tue Jun 2 12:49:01 2026
    From Newsgroup: alt.os.linux

    On 01/06/2026 22:55, Maria Sophia wrote:
    Jeff Layman wrote:
    Is messing around with Android phones one of your hobbies? Android OS is >>>> owned by Google but used mostly by people who care about privacy! The
    meaning of privacy must have changed recently.

    I would guess that most people who use a cellphone have no interest in
    privacy.


    Hi Jeff,

    I would disagree but I would half agree that 99 out of 100 people don't
    know the first thing about privacy, so, half of those 99 buy Apple devices because Apple told them it's more private, even as iOS is not private.

    My point is they care, but they don't know how to obtain any privacy.

    By far, the most important act anyone could do on any computing device, is NOT put a mothership account on that device, which is easy for Android.

    Android works better without the Google account than it does with it.

    If we only talk about Android phones, at least at the start, with
    probably little knowledge, they buy them on recommendation by the sales assistant in the phone shop based on price and (perhaps) what they want
    to use the phone for. Maybe the customer has specific interests such as wanting a good camera and screen for viewing.

    I'm pretty sure that if they don't have a Google account when they walk
    in, by the time they leave the shop they'll have one with the help of
    the sales assistant! They'll then be shown how to use Google's cloud
    storage and how to backup to it. Location, wifi, and Bluetooth will be switched on.

    I really doubt that privacy will be mentioned (and the way some people
    talk on their phone with the volume on full so you have no problem
    hearing what they and the other party are saying, means they have no
    interest in spoken privacy either!).


    Android, when used with PlugOS [1], is a super awesome privacy device,
    when additionally used with AEC [2] = Air Gapped Encrypted Communications >>> and a little air gapped GPD MicroPC [3] *with Windows 11*, which beats any >>> online Linux box with outdated GnuPG or OpenPGP, when it comes to first
    class secure and anonymous email communications, via the Nym Mixnet [4]. >>>
    [1] https://plugos.net/plugmate

    Recent reviews:

    <https://uk.pcmag.com/security/165179/i-was-sick-of-android-apps-spying-on-me-so-i-tried-grapheneos-and-plugos>

    <https://www.clubic.com/actualite-598732-plugos-un-pc-android-dans-une-cle-usb-c-securisee-ne-tombez-pas-dans-le-piege.html>
    (In French, but translatable with Firefox, or using DeepL or Google
    Translate)

    Since most USA-spec Samsung devices can't be rooted, GrapheneOS isn't available, but I didn't know about PlugOS until it was mentioned above.
    a. You plug the PlugOS USB-C stick into your phone.
    b. The phone treats it like an external display + input device.
    c. PlugOS runs on the stick, not on the phone.
    d. The phone is basically just a screen + power source .
    So it doesn't matter that USA Samsung's can't unlock the bootloader.

    PlusOS won't work for my Samsung because the phone must support DisplayPort Alt Mode, which mine doesn't support. But PlugOS even works on iOS so it's
    a nice idea for those whose USB port supports it.

    If you read those reviews of PlugOS, particularly the second one, you'll
    soon have doubts as to just how private PlugOS is:

    "A proprietary system without transparency

    The main problem is that PlugOS is completely closed. TrustKernel does
    not communicate the exact model of the processor or the source code of
    the system. The OS would be based on Android, but impossible to check
    what actually runs inside. The security white paper mentions "regular
    audits by independent third-party companies", but does not cite any
    auditor, publishes any reports and does not specify any date."

    Note also the sections "Your data quietly stored in China" and "A kick
    to the GDPR".

    If it is possible to run GrapheneOS that seems to be a better choice.
    --
    Jeff
    --- Synchronet 3.22a-Linux NewsLink 1.2
  • From Jeff Layman@Jeff@invalid.invalid to comp.mobile.android,alt.comp.os.windows-10,alt.os.linux on Tue Jun 2 12:55:00 2026
    From Newsgroup: alt.os.linux

    On 02/06/2026 10:33, Ch1ffr3punk wrote:
    Jeff Layman wrote:

    Recent reviews:

    <https://uk.pcmag.com/security/165179/i-was-sick-of-android-apps-spying-on-me-so-i-tried-grapheneos-and-plugos>

    Well, the author does not mention that it works also on Linux,
    Windows and macOS... Does Graphene supports this? And my new
    smartphone had cost me only 135 € compared to a Pixels...

    To be fair to the author the title only refers to him being concerned
    about /Android/ apps spying.

    Also, just over halfway down he states "At first glance, the advertising suggests you can simply plug the PlugMate into a Windows or macOS
    desktop device, but that isn't the case...".So Windows and macOS are
    mentioned (but not Linux).
    --
    Jeff
    --- Synchronet 3.22a-Linux NewsLink 1.2
  • From Ch1ffr3punk@ch1ffr3punk@gmail.com to comp.mobile.android,alt.comp.os.windows-10,alt.os.linux on Tue Jun 2 11:58:37 2026
    From Newsgroup: alt.os.linux

    Jeff Layman wrote:

    To be fair to the author the title only refers to him being concerned
    about /Android/ apps spying.

    Also, just over halfway down he states "At first glance, the advertising suggests you can simply plug the PlugMate into a Windows or macOS
    desktop device, but that isn't the case...".So Windows and macOS are mentioned (but not Linux).

    I use it with Windows 11 too, so that it can be used in an Internet Café, public libraries and a screenshot, for security reasons, can't be done.

    Regards
    Ch1ffr3punk
    --
    https://oc2mx.net
    --- Synchronet 3.22a-Linux NewsLink 1.2
  • From Maria Sophia@mariasophia@comprehension.com to comp.mobile.android,alt.comp.os.windows-10,alt.os.linux on Tue Jun 2 06:41:35 2026
    From Newsgroup: alt.os.linux

    Ch1ffr3punk wrote:
    To be fair to the author the title only refers to him being concerned
    about /Android/ apps spying.

    Also, just over halfway down he states "At first glance, the advertising
    suggests you can simply plug the PlugMate into a Windows or macOS
    desktop device, but that isn't the case...".So Windows and macOS are
    mentioned (but not Linux).

    I use it with Windows 11 too, so that it can be used in an Internet Café, public libraries and a screenshot, for security reasons, can't be done.

    I like the concept of PlusOS, even as I never heard of it until now.

    I never installed Tails, but if I were to consider spending a couple
    hundred bucks on a USB stick to run PlugOS, I might try Tails first.
    --- Synchronet 3.22a-Linux NewsLink 1.2
  • From Carlos E.R.@robin_listas@es.invalid to comp.mobile.android,alt.comp.os.windows-10,alt.os.linux on Tue Jun 2 17:50:35 2026
    From Newsgroup: alt.os.linux

    On 2026-06-02 13:49, Jeff Layman wrote:
    On 01/06/2026 22:55, Maria Sophia wrote:
    Jeff Layman wrote:
    Is messing around with Android phones one of your hobbies? Android
    OS is
    owned by Google but used mostly by people who care about privacy! The >>>>> meaning of privacy must have changed recently.

    I would guess that most people who use a cellphone have no interest in
    privacy.


    Hi Jeff,

    I would disagree but I would half agree that 99 out of 100 people don't
    know the first thing about privacy, so, half of those 99 buy Apple
    devices
    because Apple told them it's more private, even as iOS is not private.

    My point is they care, but they don't know how to obtain any privacy.

    By far, the most important act anyone could do on any computing
    device, is
    NOT put a mothership account on that device, which is easy for Android.

    Android works better without the Google account than it does with it.

    If we only talk about Android phones, at least at the start, with
    probably little knowledge, they buy them on recommendation by the sales assistant in the phone shop based on price and (perhaps) what they want
    to use the phone for. Maybe the customer has specific interests such as wanting a good camera and screen for viewing.

    I'm pretty sure that if they don't have a Google account when they walk
    in, by the time they leave the shop they'll have one with the help of
    the sales assistant! They'll then be shown how to use Google's cloud
    storage and how to backup to it. Location, wifi, and Bluetooth will be switched on.

    Some people, when they buy their second phone, have forgotten that they
    have a google account, and the shop assistant will create a second one
    and tell them, again, not to forget it.

    I have seen it.



    I really doubt that privacy will be mentioned (and the way some people
    talk on their phone with the volume on full so you have no problem
    hearing what they and the other party are saying, means they have no interest in spoken privacy either!).

    :-D

    ...
    --
    Cheers, Carlos.
    ES🇪🇸, EU🇪🇺;
    --- Synchronet 3.22a-Linux NewsLink 1.2
  • From Ch1ffr3punk@ch1ffr3punk@gmail.com to comp.mobile.android,alt.comp.os.windows-10,alt.os.linux on Tue Jun 2 19:28:21 2026
    From Newsgroup: alt.os.linux

    Maria Sophia wrote:
    Ch1ffr3punk wrote:
    To be fair to the author the title only refers to him being concerned about /Android/ apps spying.

    Also, just over halfway down he states "At first glance, the advertising suggests you can simply plug the PlugMate into a Windows or macOS
    desktop device, but that isn't the case...".So Windows and macOS are mentioned (but not Linux).

    I use it with Windows 11 too, so that it can be used in an Internet Caf?, public libraries and a screenshot, for security reasons, can't be done.

    I like the concept of PlusOS, even as I never heard of it until now.

    I never installed Tails, but if I were to consider spending a couple
    hundred bucks on a USB stick to run PlugOS, I might try Tails first.

    Problem with Tails is that you can't use it in an Internet Café etc.
    with Android, hence the reason why I purchased PlugOS where I can use
    the Nym Mixnet or Tor Network.

    Regards
    Ch1ffr3punk
    --
    https://oc2mx.net
    --- Synchronet 3.22a-Linux NewsLink 1.2
  • From Maria Sophia@mariasophia@comprehension.com to comp.mobile.android,alt.comp.os.windows-10,alt.os.linux on Tue Jun 2 18:45:13 2026
    From Newsgroup: alt.os.linux

    Carlos E.R. wrote:
    I'm pretty sure that if they don't have a Google account when they walk
    in, by the time they leave the shop they'll have one with the help of
    the sales assistant! They'll then be shown how to use Google's cloud
    storage and how to backup to it. Location, wifi, and Bluetooth will be
    switched on.

    Some people, when they buy their second phone, have forgotten that they
    have a google account, and the shop assistant will create a second one
    and tell them, again, not to forget it.

    I'm gonna discuss something that likely .001% of people on earth know.

    I would agree with everyone that the common experience is the shop
    personnel (who migrate phones all day, every day) will be using their
    Google account to migrate the apps over.

    They even tried that with me when I had my free phone replaced (twice!)
    under warranty due to me screwing it up by sleeping on it & bricking it.

    Bear in mind when I transfer a phone's apps, I transfer the exact
    homescreen (icon names and locations exactly) which people will never get
    with the Google transfer.
    <https://i.postimg.cc/Gmbyp807/windows-android.jpg>

    I also transfer the exact sub versions (if I want to), which, again, people don't get with the Google transfer.
    <https://i.postimg.cc/FFYqg9Dv/maps05.jpg> map tools apk archive

    Since the app isn't installed at first, when that homescreen is copied
    over, most of the app icons are grayed out, but I only have to tap them.
    <https://i.postimg.cc/Kv8RmGT3/telecom.jpg> homescreen gray icons

    Likely 0.001% of the people on earth can even understand what I just said.
    If they use the Google method, they lose out on all this simplicity.

    I'll wager no clerk in any phone store has any clue of what I just said.
    --
    On Usenet, old men with vast experience voluntarily share that knowledge.
    --- Synchronet 3.22a-Linux NewsLink 1.2
  • From Maria Sophia@mariasophia@comprehension.com to comp.mobile.android,alt.comp.os.windows-10,alt.os.linux on Tue Jun 2 20:53:12 2026
    From Newsgroup: alt.os.linux

    Ch1ffr3punk wrote:
    I like the concept of PlusOS, even as I never heard of it until now.

    I never installed Tails, but if I were to consider spending a couple
    hundred bucks on a USB stick to run PlugOS, I might try Tails first.

    Problem with Tails is that you can't use it in an Internet Café etc.
    with Android, hence the reason why I purchased PlugOS where I can use
    the Nym Mixnet or Tor Network.

    Good point.
    I just checked and PlugOS doesn't work with Android, as you noted.

    Given Andronix puts Linux on Android for free <https://andronix.app/>,
    I checked if Tails would work with Linux on Android, but it won't.

    Drat.

    For a non-rooted Android, about the best you can do that PlugOS does
    is Tor browsing and Orbot routing (unlike LineageOS which requires root).

    For Pixels, there's also GrapheneOS/CalyxOS which works without rooting.
    But USA-spec Samsung bootloaders are locked (as far as anyone knows).

    The only downside, I see, of PlugOS is the cost as those above are free.

    I don't know if it requires an account, but once you pay for anything,
    using an account, then your privacy using that thing, is usually toast.
    --- Synchronet 3.22a-Linux NewsLink 1.2
  • From Maria Sophia@mariasophia@comprehension.com to comp.mobile.android,alt.comp.os.windows-10,alt.os.linux on Tue Jun 2 20:55:00 2026
    From Newsgroup: alt.os.linux

    Maria Sophia wrote:
    I just checked and PlugOS doesn't work with Android, as you noted.

    correction
    I just checked and *TAILS* doesn't work with Android/Andronix,
    as you noted.
    --- Synchronet 3.22a-Linux NewsLink 1.2
  • From Carlos E.R.@robin_listas@es.invalid to comp.mobile.android,alt.comp.os.windows-10,alt.os.linux on Wed Jun 3 11:21:15 2026
    From Newsgroup: alt.os.linux

    On 2026-06-03 02:45, Maria Sophia wrote:
    Bear in mind when I transfer a phone's apps, I transfer the exact
    homescreen (icon names and locations exactly) which people will never get with the Google transfer.

    But this depends on you using a different home screen app.
    --
    Cheers, Carlos.
    ES🇪🇸, EU🇪🇺;
    --- Synchronet 3.22a-Linux NewsLink 1.2
  • From Maria Sophia@mariasophia@comprehension.com to comp.mobile.android,alt.comp.os.windows-10,alt.os.linux on Wed Jun 3 06:59:12 2026
    From Newsgroup: alt.os.linux

    Carlos E.R. wrote:
    On 2026-06-03 02:45, Maria Sophia wrote:
    Bear in mind when I transfer a phone's apps, I transfer the exact
    homescreen (icon names and locations exactly) which people will never get
    with the Google transfer.

    But this depends on you using a different home screen app.

    Yes. You understood. You're in the top 0.001% as a result of understanding.

    You bring up a good point because you understood.
    I build the solutions from the moment a computing device is in my control.

    My strategy is to use tactics to preserve the homescreen between phones.
    <https://i.postimg.cc/3r0yNRcT/network02.jpg> network tools folder
    <https://i.postimg.cc/BZwR6gXc/buy02.jpg> shopping tools folder
    <https://i.postimg.cc/CMmSsgtN/maps01.jpg> map tools folder
    <https://i.postimg.cc/CxTxzsfC/sys01.jpg> system tools folder
    <https://i.postimg.cc/FFYqg9Dv/maps05.jpg> map tools apk archive
    <https://i.postimg.cc/fRNg5hn0/audio01.jpg> audio tools folder
    <https://i.postimg.cc/fTFcQ5d4/dock.jpg> dock tools folder
    <https://i.postimg.cc/pLFpXfMP/maps07.jpg> maps offline/online sections
    <https://i.postimg.cc/rmvDBN8Q/files01.jpg> file management tools folder
    <https://i.postimg.cc/vTQ13DcK/apk01.jpg> installation tools folder
    <https://i.postimg.cc/vZmTvPZx/maps02.jpg> map folder traffic section
    <https://i.postimg.cc/WpM4FM5t/web01.jpg> web tools folder
    <https://i.postimg.cc/XvN1Scvj/video01.jpg> video tools folder
    <https://i.postimg.cc/Zn73yqm1/network03.jpg> network tools server section
    etc.

    Given your understanding, you also made me think about a solution...
    The home screen app (aka, launcher) is easily changed on demand.

    So, while I use the last known good version of the free Nova launcher,
    <https://tinyurl.com/nova-launcher>
    any launcher that backs up the homescreen can be used to do it.

    In addition, anyone could install a suitable backup launcher moments before backing up their home screen. I haven't tested what happens when you switch home screens, but it could be that the home screen is also then preserved.

    So this is what could be tested by someone who cares to test for the team.

    1. Set up your folders & icons on your current launcher as you wish
    2. Temporarily, switch to the Nova (or similar) backup-capable launcher
    3. Save the homescreen to a backup file
    4. Switch back to your current launcher

    This "should" save the position of the folders and apps.
    But I haven't tested if folder contents, position & names are preserved.
    --- Synchronet 3.22a-Linux NewsLink 1.2